PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6948729 to PF03649 (UPF0014)

VIMSS6948729 has 250 amino acids

Query:       UPF0014  [M=242]
Accession:   PF03649.13
Description: Uncharacterised protein family (UPF0014)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    7.4e-90  286.6  19.2    8.3e-90  286.4  19.2    1.0  1  VIMSS6948729  


Domain annotation for each sequence (and alignments):
>> VIMSS6948729  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  286.4  19.2   8.3e-90   8.3e-90       2     242 .]       4     240 ..       3     240 .. 0.99

  Alignments for each domain:
  == domain 1  score: 286.4 bits;  conditional E-value: 8.3e-90
       UPF0014   2 lqlalalllvlialllslvlklglekelliaavrmvvQLllvGyvLklifalnslllvllillvmllvAaieaakrvkkklkklllivllsllvstl 98 
                   l+l+la +lvli++++s+++klg+eke++i+++r+vvQL++vGy+L++ifa+n+ l++l+++++m++vA+ +a kr +k +++++  +++s+++s++
  VIMSS6948729   4 LSLTLASSLVLISIFVSYYQKLGIEKEIVIGTIRAVVQLTIVGYILHYIFAANNALFTLAMVALMIVVAGNNASKR-GKGIPNVFYFITFSIALSAA 99 
                   6899************************************************************************.******************** PP

       UPF0014  99 ltlllllllviqpepwyepqylIPlaGmilGnamnaialalerllselksereeiealLalGatpkeAvkeivreairaaliPtinsmatvGlVsLP 195
                   +t+ ll+l    +++ ++pq +IP++Gmi+Gn+m a +la++rl +e+k+++eeiea+L+lGat ++A+++++++ai++++iPt++sm+t+G+V+LP
  VIMSS6948729 100 ITISLLIL---FGNIHFRPQEVIPVSGMIVGNSMVASGLAVSRLKDEIKNKSEEIEAYLSLGATSRQAAQKVIKTAIKTGMIPTVDSMKTLGIVQLP 193
                   ***99999...5689********************************************************************************** PP

       UPF0014 196 GmmtGqiLaGaspleAvkyqilimfmilastalstvlvvlllyrrlf 242
                   GmmtG+iL+G++p++Avkyqi+++fm+++++++s++ v++l+yr++f
  VIMSS6948729 194 GMMTGLILGGVDPINAVKYQIMVTFMLASTVSISCFSVTFLTYRNFF 240
                   *********************************************99 PP



Or compare VIMSS6948729 to CDD or PaperBLAST