PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS9955484 to PF03649 (UPF0014)

VIMSS9955484 has 282 amino acids

Query:       UPF0014  [M=242]
Accession:   PF03649.13
Description: Uncharacterised protein family (UPF0014)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.3e-76  241.9  18.4    3.7e-76  241.7  18.4    1.0  1  VIMSS9955484  


Domain annotation for each sequence (and alignments):
>> VIMSS9955484  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  241.7  18.4   3.7e-76   3.7e-76       5     242 .]      36     269 ..      32     269 .. 0.97

  Alignments for each domain:
  == domain 1  score: 241.7 bits;  conditional E-value: 3.7e-76
       UPF0014   5 alalllvlialllslvlklglekelliaavrmvvQLllvGyvLklifalnslllvllillvmllvAaieaakrvkkklkklllivllsllvstlltl 101
                   ++a ++v++a++ls+ ++lgle e+l+a++r+++QL ++G+vL++if++++ l++ll +l+m++vA+++a +r +k++++   i+++s+lv+t++t+
  VIMSS9955484  36 VAATAVVAMAVALSFSQRLGLEGEMLYATARAFLQLSVIGFVLQFIFTQKNALWILLAYLFMVTVAGYTAGQR-AKQVPRGKYIAFVSILVGTAVTV 131
                   578999*******************************************************************.777888888************** PP

       UPF0014 102 llllllviqpepwyepqylIPlaGmilGnamnaialalerllselksereeiealLalGatpkeAvkeivreairaaliPtinsmatvGlVsLPGmm 198
                   ll +ll +    +++p+y+IPlaGmi+Gnam+++++++++l +++k +r+ +e++LalGatp++A+++ v++++  al P i+s++tvGl++LPG+m
  VIMSS9955484 132 LLPVLLGV---FPFTPRYIIPLAGMIIGNAMTVTGVTMKKLREDIKIQRDLVETALALGATPRQATRQQVKRSLVIALSPDIDSAKTVGLITLPGTM 225
                   ***99888...9************************************************************************************* PP

       UPF0014 199 tGqiLaGaspleAvkyqilimfmilastalstvlvvlllyrrlf 242
                   tG+i++GaspleA+++qi++++m+l+++++s++l+++l+   +f
  VIMSS9955484 226 TGLIMGGASPLEAIQLQIVVTYMLLSASTVSSILSTYLCWPAFF 269
                   **************************************988887 PP



Or compare VIMSS9955484 to CDD or PaperBLAST