PaperBLAST – Find papers about a protein or its homologs

 

Align NP_013077.1 to PF03661 (UPF0121)

NP_013077.1 has 279 amino acids

Query:       UPF0121  [M=241]
Accession:   PF03661.13
Description: Uncharacterised protein family (UPF0121)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.2e-28   86.2  16.7    2.9e-28   85.0  16.7    1.5  1  NP_013077.1  


Domain annotation for each sequence (and alignments):
>> NP_013077.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   85.0  16.7   2.9e-28   2.9e-28      13     238 ..      27     263 ..      15     265 .. 0.79

  Alignments for each domain:
  == domain 1  score: 85.0 bits;  conditional E-value: 2.9e-28
      UPF0121  13 lkankielalwltrlltllftvlyliplflsssysaYykallanaatsalrlhqrl..........pqlrls....reylerllledsvhyLlysliF 96 
                  ++a+ +++a++  ++++l++++lyl+   +s     Y+ a l  + ++ ++++q++          +  + +    ++ ++ ll  + v yL+++  +
  NP_013077.1  27 AVAKSLQFAWFTGHSVVLISSILYLLK--MS--EFYYRSAYLGVIESFGIIIYQQFftrneplqtqD-AAATkasiKSRVAGLLKSEDVLYLVLANFW 119
                  356889*******************95..33..234566778888999******9887654332211.122211112345679999************ PP

      UPF0121  97 lfsaPvtlallPvflfallHaasytktlld....vlgsnslvvarllkvi.slvesqaeniLrliAlieivlmpllivl.lllgkaslllpllYyqfL 188
                  lf + ++ +l+P+f fa++H++ y++++l      l+s+++   ++l+ i ++v + +   ++++   e++++ l+++  +l +++s +++++Y+ f+
  NP_013077.1 120 LFTPRFSFSLIPFFAFAVFHVLIYVEKVLLpkvfHLSSKDS--SKILSFIdKFVVQYNDLCMHWVGTAELLIFILVLFRaILCFQRSWIILVVYAIFI 215
                  *****************************999664444444..566644516666667779*********99888777516789************** PP

      UPF0121 189 klRYsSrrnPytreafseLrvlletlanhpscPavirslieklialvsrl 238
                  klRY    + y+++af++ rv ++ +++hps+P++++++++ +   ++rl
  NP_013077.1 216 KLRYE--NSKYMKAAFAQWRVRMDGIISHPSIPPFVKRAYNAIKMSLIRL 263
                  *****..*********************************9987666665 PP



Or compare NP_013077.1 to CDD or PaperBLAST