PaperBLAST – Find papers about a protein or its homologs

 

Align NP_060596.2 to PF03661 (UPF0121)

NP_060596.2 has 247 amino acids

Query:       UPF0121  [M=241]
Accession:   PF03661.13
Description: Uncharacterised protein family (UPF0121)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   5.4e-100  319.8  12.8   6.4e-100  319.6  12.8    1.0  1  NP_060596.2  


Domain annotation for each sequence (and alignments):
>> NP_060596.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  319.6  12.8  6.4e-100  6.4e-100       8     240 ..      13     244 ..       7     245 .. 0.98

  Alignments for each domain:
  == domain 1  score: 319.6 bits;  conditional E-value: 6.4e-100
      UPF0121   8 sllqhlkankielalwltrlltllftvlyliplflss.sysaYykallanaatsalrlhqrlpqlrlsreylerllledsvhyLlysliFlfsaPvtl 104
                   ++q++++nk+++a+wl+rl+t+++++l+++pl++ + ++s+Y++allana+tsalrlhqrlp+++lsr++l+++lleds+hyLlysliF++s+Pvt+
  NP_060596.2  13 GAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHeAASFYQRALLANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTM 110
                  5789*******************************999999********************************************************* PP

      UPF0121 105 allPvflfallHaasytktlldvlgsnslvvarllkvislvesqaeniLrliAlieivlmpllivllllgkaslllpllYyqfLklRYsSrrnPytre 202
                  +++Pv+lf+llHaa+ytk++ld  gsnsl++ r +  +++++++++niL++iA++ei+lmp+++++l++g+ sll+p++Yy+fL+lRYsSrrnPy+r+
  NP_060596.2 111 SIFPVLLFSLLHAATYTKKVLDARGSNSLPLLRSV--LDKLSANQQNILKFIACNEIFLMPATVFMLFSGQGSLLQPFIYYRFLTLRYSSRRNPYCRT 206
                  *****************************999988..9************************************************************ PP

      UPF0121 203 afseLrvlletlanhpscPavirslieklialvsrlap 240
                  +f+eLr+++e+++++p cP ++r+l+ ++ia++srlap
  NP_060596.2 207 LFNELRIVVEHIIMKPACPLFVRRLCLQSIAFISRLAP 244
                  *************************************9 PP



Or compare NP_060596.2 to CDD or PaperBLAST