PaperBLAST – Find papers about a protein or its homologs

 

Align NP_596818.1 to PF03661 (UPF0121)

NP_596818.1 has 279 amino acids

Query:       UPF0121  [M=241]
Accession:   PF03661.13
Description: Uncharacterised protein family (UPF0121)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.2e-39  120.5  14.9    5.2e-39  120.2  14.9    1.0  1  NP_596818.1  


Domain annotation for each sequence (and alignments):
>> NP_596818.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  120.2  14.9   5.2e-39   5.2e-39      15     239 ..      19     256 ..       6     258 .. 0.91

  Alignments for each domain:
  == domain 1  score: 120.2 bits;  conditional E-value: 5.2e-39
      UPF0121  15 ankielalwltrlltllftvlyli.plflss.sysaYykallanaatsalrlhqrl.....pqlrlsreylerllledsvhyLlysliFlfsaPvtla 105
                  ++ ++++++  ++++l+++vly + ++ ++s +   +  a+  +++++a++l++ +     ++ ++++++++rl+l+d+v+y++++l  l+ +P+  +
  NP_596818.1  19 VKNTQFVWFSGQVIVLISSVLYALqAIPFRSaPPFLFKSAAFGAIVAYAIVLYKTYspnltSRASWNKHFFARLMLDDNVQYFILALSMLIDRPILFS 116
                  57789******************9999888777779******************99755555669********************************* PP

      UPF0121 106 llPvflfallHaasytktlld.......vlgsnslvvarll.kvislvesqaeniLrliAlieivlmpllivllllgkaslllpllYyqfLklRYsSr 195
                  l P++++a++H+++y++++l        +  ++ + + r++  + +   sq + +++l+A  e +l++ l++ ++l k+s+  ++ Y  fL++RY+  
  NP_596818.1 117 LAPYAIYATFHISTYLRSVLLpaiypniSDAKTASYASRVSnLLNQYTRSQFQPAMQLVASLETFLLFRLFFGVFLRKNSISRLVGYIFFLRMRYT-- 212
                  *************************97633334446667763446778889999******************************************.. PP

      UPF0121 196 rnPytreafseLrvlletlanhpscPavirslieklialvsrla 239
                   +  tr+ ++++ + +++l++  ++P+vi+++ ++    vs+ +
  NP_596818.1 213 NSHFTRASIKAVSLRMDRLVADNRVPPVIKNAWHTFKTYVSKFG 256
                  9**********************************999999875 PP



Or compare NP_596818.1 to CDD or PaperBLAST