PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9V447 to PF03661 (UPF0121)

SwissProt::Q9V447 has 276 amino acids

Query:       UPF0121  [M=241]
Accession:   PF03661.13
Description: Uncharacterised protein family (UPF0121)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    4.5e-94  300.4  15.6    5.5e-94  300.1  15.6    1.0  1  SwissProt::Q9V447  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9V447  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  300.1  15.6   5.5e-94   5.5e-94       7     241 .]      39     268 ..      31     268 .. 0.98

  Alignments for each domain:
  == domain 1  score: 300.1 bits;  conditional E-value: 5.5e-94
            UPF0121   7 ksllqhlkankielalwltrlltllftvlyliplflsssysaYykallanaatsalrlhqrlpqlrlsreylerllledsvhyLlysliFlf 98 
                        ++llqh+++n+i++alw++rll+++ftv+y++p+f+s ++sa+ k++lanaa+salrlhqrlp++++sre+l+rl+ eds+hy++ysliF++
  SwissProt::Q9V447  39 AKLLQHFQTNRIDSALWALRLLVIFFTVSYVLPIFTS-QQSAFSKVMLANAAISALRLHQRLPAFAFSREFLARLFAEDSCHYMMYSLIFFN 129
                        789**********************************.999*************************************************** PP

            UPF0121  99 saPvtlallPvflfallHaasytktlldvlgsnslvvarllkvislvesqaeniLrliAlieivlmpllivllllgkaslllpllYyqfLkl 190
                        ++P  l+l+Pv+l+++lHa+sy+++lld++g+ns+++ar++  is+ve+qa+niL++ A++ei++mp++ivl+++++a l++p++Yy++L +
  SwissProt::Q9V447 130 IRPSLLVLIPVLLYSVLHASSYSLKLLDLIGQNSWWGARFI--ISIVEFQAANILKATAFCEIFIMPYAIVLAFMNHAGLMTPVIYYHYLVM 219
                        *****************************************..************************************************* PP

            UPF0121 191 RYsSrrnPytreafseLrvlletlanhpscPavirslieklialvsrlapp 241
                        RYsSrrnPy r+af+eLr+++e+la+++  P+++ ++i++ i++v+rlap+
  SwissProt::Q9V447 220 RYSSRRNPYPRNAFAELRITFEALAARS--PPAFAKIIRGGIGFVNRLAPQ 268
                        ************************9987..9******************96 PP



Or compare SwissProt::Q9V447 to CDD or PaperBLAST