PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10092272 to PF03661 (UPF0121)

VIMSS10092272 has 348 amino acids

Query:       UPF0121  [M=241]
Accession:   PF03661.13
Description: Uncharacterised protein family (UPF0121)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    2.3e-20   59.1   7.0    3.1e-20   58.7   7.0    1.1  1  VIMSS10092272  


Domain annotation for each sequence (and alignments):
>> VIMSS10092272  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   58.7   7.0   3.1e-20   3.1e-20      19     193 ..     127     305 ..     113     327 .. 0.87

  Alignments for each domain:
  == domain 1  score: 58.7 bits;  conditional E-value: 3.1e-20
        UPF0121  19 elalwltrlltllftvlyliplflss.sysaYykallanaatsalrlhqrlpql.rlsre....ylerllledsvhyLlysliFlfsa.Pvtlall 107
                    +++++  +  + +++vl ++pl+ ++ s  aY+  ++ +a +s+  l+  ++++ +++ +    y+++++    + y++y+l F++s+  +  al+
  VIMSS10092272 127 QTIQFSVNAWVFVIAVLAVLPLIPKNlSNRAYRLSFMGTACSSLYSLYSLYGRPrAWNMQglqvYFQSIVAAKDFIYFIYCLTFVTSHlCLKFALI 222
                    78899999999999***********99999******************999887556644444499*********************934689*** PP

        UPF0121 108 PvflfallHaasytktlldvlgsnslvvarllkvislvesqaeniLrliAlieivlmpllivllllgkaslllpllYyqfLklRYs 193
                    P+++ al  +a +++     +g ++   + l +   +ves++ ++  l +  ei++ +lli+ ll+ ++++++ ++Y+q Lkl Y+
  VIMSS10092272 223 PILCRALEQVAKFLRRN---FGRSTIYRKYLEDPCVWVESNTTTLNILSSQAEIAIGFLLIISLLSWQRNIIQTFMYWQLLKLMYQ 305
                    *************9974...5665554444448899*****99966777889*******************************998 PP



Or compare VIMSS10092272 to CDD or PaperBLAST