PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS104844 to PF03729 (DUF308)

VIMSS104844 has 170 amino acids

Query:       DUF308  [M=73]
Accession:   PF03729.13
Description: Short repeat of unknown function (DUF308)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.9e-23   67.6  64.7      1e-16   47.4  14.0    3.1  3  VIMSS104844  


Domain annotation for each sequence (and alignments):
>> VIMSS104844  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   47.4  14.0     1e-16     1e-16       1      73 []      14      86 ..      14      86 .. 0.98
   2 !   27.7  21.8   1.4e-10   1.4e-10       2      73 .]      73     140 ..      72     140 .. 0.91
   3 !   17.6  12.9   1.9e-07   1.9e-07       4      44 ..     129     169 ..     126     170 .] 0.95

  Alignments for each domain:
  == domain 1  score: 47.4 bits;  conditional E-value: 1e-16
       DUF308  1 llGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllllf 73
                 ++G+ll+ l+++++++P     a+++l+G+++l+ G++qii   +a++  +g+  + l++Gi+ +++Gl+++f
  VIMSS104844 14 IMGVLLLMLAVVIFTFPIENFYAITWLIGLFVLINGVIQIIYRRKAKALVGGNQNWILFMGIVDILFGLIVIF 86
                 79***************************************999********999****************98 PP

  == domain 2  score: 27.7 bits;  conditional E-value: 1.4e-10
       DUF308   2 lGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllllf 73 
                  +Gi+ i++G++++++ +a++++++++f++++++s+i++++ +f   + +++ ++ ++++ +l +++G++llf
  VIMSS104844  73 MGIVDILFGLIVIFNVGASSAFFIYMFAFWFIFSSIAGLF-TF--TG-SGSLKLISVIFNLLGIVFGVILLF 140
                  8**************************************6.55..44.566677999*************98 PP

  == domain 3  score: 17.6 bits;  conditional E-value: 1.9e-07
       DUF308   4 illivlGilalllPvaallalvllfGilllvsGivqiiaaf 44 
                  +l iv+G+++l++P++ +++++++++i +++ G+++++ a+
  VIMSS104844 129 LLGIVFGVILLFNPLMGIVFISTMIAIAFVFVGVIYVVDAL 169
                  588**********************************9886 PP



Or compare VIMSS104844 to CDD or PaperBLAST