PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1140981 to PF03729 (DUF308)

VIMSS1140981 has 174 amino acids

Query:       DUF308  [M=73]
Accession:   PF03729.13
Description: Short repeat of unknown function (DUF308)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    6.8e-24   70.4  39.2    8.8e-16   44.4  12.9    3.0  3  VIMSS1140981  


Domain annotation for each sequence (and alignments):
>> VIMSS1140981  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   44.4  12.9   8.8e-16   8.8e-16       1      72 [.       9      78 ..       9      79 .. 0.93
   2 !   32.7  18.5   3.9e-12   3.9e-12       3      72 ..      67     135 ..      65     136 .. 0.91
   3 !   13.2   1.3   4.8e-06   4.8e-06      12      49 ..     134     171 ..     133     174 .] 0.91

  Alignments for each domain:
  == domain 1  score: 44.4 bits;  conditional E-value: 8.8e-16
        DUF308  1 llGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllll 72
                  ++Gil+++ Gi+al++P+ ++la+++l G ++++sG+++++aaf+ r+   +g     ++++++l+aG+++l
  VIMSS1140981  9 VSGILALLGGIAALAFPLPVSLAVTVLAGCVFVASGAFGLWAAFSDRGMPSRGA--AAFFSLVSLVAGVWML 78
                  68******************************************8888777665..588************9 PP

  == domain 2  score: 32.7 bits;  conditional E-value: 3.9e-12
        DUF308   3 GillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllll 72 
                   +++++v+G+++l++P+a ++ l+l++G+l+lvsG+v++  ++a+++ +   +wl+ l+G+++  +Gl++l
  VIMSS1140981  67 SLVSLVAGVWMLANPLAGMVSLTLMLGALFLVSGVVRLGLSLATWR-GTVMFWLMALSGLISAGLGLFIL 135
                   789***********************************77776666.666799999************98 PP

  == domain 3  score: 13.2 bits;  conditional E-value: 4.8e-06
        DUF308  12 lalllPvaallalvllfGilllvsGivqiiaafaarkk 49 
                   ++l lP a+l+ l +l+++ l+v G++ ++ +fa rk+
  VIMSS1140981 134 ILLRLPEASLVLLGTLVAVELIVMGATLVAMGFALRKS 171
                   7899*****************************88875 PP



Or compare VIMSS1140981 to CDD or PaperBLAST