PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS144067 to PF03729 (DUF308)

VIMSS144067 has 189 amino acids

Query:       DUF308  [M=73]
Accession:   PF03729.13
Description: Short repeat of unknown function (DUF308)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.9e-27   80.4  34.7    2.8e-17   49.2  16.3    3.0  3  VIMSS144067  


Domain annotation for each sequence (and alignments):
>> VIMSS144067  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   49.2  16.3   2.8e-17   2.8e-17       1      72 [.      26      97 ..      26      98 .. 0.97
   2 !   44.0  10.4   1.2e-15   1.2e-15       1      71 [.      84     152 ..      84     154 .. 0.95
   3 !    3.0   1.2     0.007     0.007      17      41 ..     157     181 ..     151     189 .] 0.79

  Alignments for each domain:
  == domain 1  score: 49.2 bits;  conditional E-value: 2.8e-17
       DUF308  1 llGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllll 72
                 ++++ll++ Gi++l++P+a+++al++++Gilll+sGi+ i++ +a+r+ n +  + g+llG+ y+++G++++
  VIMSS144067 26 IVAVLLLLGGIFCLINPLASGAALSMVIGILLLLSGIAMIVGMIANRSDNFWPMVAGILLGVAYIVMGYVFI 97
                 689*********************************************9999999***************99 PP

  == domain 2  score: 44.0 bits;  conditional E-value: 1.2e-15
       DUF308   1 llGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGlll 71 
                  llG+ +iv G +++++P++ ++ l++++++l+ ++G++++i++f  ++ +r g wl++llG+l l++ +ll
  VIMSS144067  84 LLGVAYIVMGYVFITNPAIGMISLAVVLAVLFAFGGVLRLINGF--KDLKRPGAWLQILLGVLDLVITYLL 152
                  68******************************************..8888999*************98776 PP

  == domain 3  score: 3.0 bits;  conditional E-value: 0.007
       DUF308  17 PvaallalvllfGilllvsGivqii 41 
                  P+++++++++l+Gi +l+s++  ++
  VIMSS144067 157 PLMSITMVTTLVGIEMLFSSFSCFM 181
                  89999************99987764 PP



Or compare VIMSS144067 to CDD or PaperBLAST