PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS156823 to PF03729 (DUF308)

VIMSS156823 has 175 amino acids

Query:       DUF308  [M=73]
Accession:   PF03729.13
Description: Short repeat of unknown function (DUF308)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.7e-37  112.5  61.9    1.5e-21   62.9  11.7    3.0  3  VIMSS156823  


Domain annotation for each sequence (and alignments):
>> VIMSS156823  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   62.9  11.7   1.5e-21   1.5e-21       1      73 []      11      82 ..      11      82 .. 0.96
   2 !   47.6  18.1   8.7e-17   8.7e-17       3      73 .]      70     140 ..      68     140 .. 0.93
   3 !   27.2  16.1   1.9e-10   1.9e-10       2      46 ..     127     171 ..     126     175 .] 0.91

  Alignments for each domain:
  == domain 1  score: 62.9 bits;  conditional E-value: 1.5e-21
       DUF308  1 llGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllllf 73
                 l Gi +i+lG+++l++P+++ll+++l+fG+lll+sGi++ i++f+ rk+++ ++w  l+ Gil++++G+lllf
  VIMSS156823 11 LAGIAMIILGVWFLFHPGISLLTSTLMFGFLLLISGIFHTISYFSDRKSQNVSGW-VLADGILSILLGFLLLF 82
                 57*************************************************9996.888************98 PP

  == domain 2  score: 47.6 bits;  conditional E-value: 8.7e-17
       DUF308   3 GillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrw.lglllGilyliaGllllf 73 
                  Gil+i+lG+l+l++ +  +l+lvllfG+++l++Gi++ i+af+a+++n +g w + l++Gi+ +i+G+++lf
  VIMSS156823  70 GILSILLGFLLLFNEFDGTLTLVLLFGMWVLFAGIMRTIGAFTAKQNNVQG-WgWILTIGIIGIIVGFIALF 140
                  9*****************************************888866665.55****************98 PP

  == domain 3  score: 27.2 bits;  conditional E-value: 1.9e-10
       DUF308   2 lGillivlGilalllPvaallalvllfGilllvsGivqiiaafaa 46 
                  +Gi+ i++G++al++Pv++++ +vl+++i+++v Gi+ i++ f+ 
  VIMSS156823 127 IGIIGIIVGFIALFNPVVSAIGIVLVVAIFFIVQGIGAIATFFFI 171
                  7**************************************887765 PP



Or compare VIMSS156823 to CDD or PaperBLAST