PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS281929 to PF03729 (DUF308)

VIMSS281929 has 326 amino acids

Query:       DUF308  [M=73]
Accession:   PF03729.13
Description: Short repeat of unknown function (DUF308)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.9e-19   54.3  38.3    3.6e-14   39.2  14.3    3.1  3  VIMSS281929  


Domain annotation for each sequence (and alignments):
>> VIMSS281929  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   39.2  14.3   3.6e-14   3.6e-14       1      72 [.     161     232 ..     161     233 .. 0.97
   2 !   13.9   7.5   2.9e-06   2.9e-06      21      72 ..     243     289 ..     237     290 .. 0.84
   3 !   19.5   8.3     5e-08     5e-08       2      48 ..     277     323 ..     276     326 .] 0.92

  Alignments for each domain:
  == domain 1  score: 39.2 bits;  conditional E-value: 3.6e-14
       DUF308   1 llGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllll 72 
                  ++G+ +i+lG+++ll+P  +l+  +ll+G+++++sG+v+i++a+   +  +g r+l++++Gil+  +G++++
  VIMSS281929 161 VVGVAAIALGAALLLVPNKTLALAALLLGVYFVISGVVRIVSALVEPGLPGGWRVLDVFVGILLTFGGVVVV 232
                  69**********************************************9999999**************986 PP

  == domain 2  score: 13.9 bits;  conditional E-value: 2.9e-06
       DUF308  21 llalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllll 72 
                  +l ++l++G+ +++ G++++++++  r   ++ + + ++ +i+++iaG+++l
  VIMSS281929 243 ALLITLMVGFGWIMEGVLSLVESW--RI-PHS-G-WAIAYAIISIIAGFVVL 289
                  57899****************888..44.333.3.799***********998 PP

  == domain 3  score: 19.5 bits;  conditional E-value: 5e-08
       DUF308   2 lGillivlGilalllPvaallalvllfGilllvsGivqiiaafaark 48 
                   +i++i++G+++l+ P+ ++++++++ G  ++v Gi+++i af++ k
  VIMSS281929 277 YAIISIIAGFVVLMSPLSSAVFMIIFGGCAMVVMGITSVIRAFTFGK 323
                  689****************************************7665 PP



Or compare VIMSS281929 to CDD or PaperBLAST