PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS306066 to PF03729 (DUF308)

VIMSS306066 has 190 amino acids

Query:       DUF308  [M=73]
Accession:   PF03729.13
Description: Short repeat of unknown function (DUF308)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.3e-22   66.3  37.9    3.5e-16   45.7  14.1    3.1  3  VIMSS306066  


Domain annotation for each sequence (and alignments):
>> VIMSS306066  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   45.7  14.1   3.5e-16   3.5e-16       2      72 ..      27      97 ..      26      98 .. 0.95
   2 !   33.0  14.1     3e-12     3e-12       1      72 [.      84     153 ..      84     154 .. 0.93
   3 !    4.1   2.8    0.0033    0.0033      13      40 ..     153     180 ..     151     190 .] 0.78

  Alignments for each domain:
  == domain 1  score: 45.7 bits;  conditional E-value: 3.5e-16
       DUF308  2 lGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllll 72
                 +++ll ++G+l++++P++++ +l++++G+ll++sGi+ i++ f++r++n +  + g+l+++ yl++G++++
  VIMSS306066 27 IAVLLFIVGLLCISFPFVSGDILSTVVGALLICSGIALIVGLFSNRSHNFWPVLSGFLVAVAYLLIGYFFI 97
                 68*****************************************99999988888999************98 PP

  == domain 2  score: 33.0 bits;  conditional E-value: 3e-12
       DUF308   1 llGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllll 72 
                  l+++ ++++G +++  P + ++a++ +++ l++v+G++++++ +  r+++ +g wl+l++G+l ++++ ++l
  VIMSS306066  84 LVAVAYLLIGYFFIRAPELGIFAIAAFIAGLFCVAGVIRLMSWY--RQRSMKGSWLQLVIGVLDIVIAWIFL 153
                  5899************************************9888..55567778****************97 PP

  == domain 3  score: 4.1 bits;  conditional E-value: 0.0033
       DUF308  13 alllPvaallalvllfGilllvsGivqi 40 
                  + + P+++++ +++l+Gi l++s++  +
  VIMSS306066 153 LGATPMVSVTLVSTLVGIELIFSAASLF 180
                  55789*****************998766 PP



Or compare VIMSS306066 to CDD or PaperBLAST