PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS33397 to PF03729 (DUF308)

VIMSS33397 has 195 amino acids

Query:       DUF308  [M=73]
Accession:   PF03729.13
Description: Short repeat of unknown function (DUF308)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.2e-26   79.2  59.6    1.3e-15   43.8  20.7    3.0  3  VIMSS33397  


Domain annotation for each sequence (and alignments):
>> VIMSS33397  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   43.8  20.7   1.3e-15   1.3e-15       2      72 ..      30      99 ..      29     100 .. 0.93
   2 !   28.4  15.3   8.6e-11   8.6e-11       1      72 [.      86     155 ..      86     156 .. 0.90
   3 !   32.5   7.6   4.5e-12   4.5e-12       2      50 ..     143     191 ..     142     194 .. 0.94

  Alignments for each domain:
  == domain 1  score: 43.8 bits;  conditional E-value: 1.3e-15
      DUF308  2 lGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllll 72
                +Gil+++lG+l+l++P++++l+ ++ fG++ll+ G++q++ af+ +  + ggr+l +++G+ +li+++l++
  VIMSS33397 30 SGILSLILGVLVLAWPGISILVAAMAFGVYLLITGVAQVAFAFSLHV-SAGGRILLFISGAASLILAVLAF 99
                8******************************************8887.555699**************987 PP

  == domain 2  score: 28.4 bits;  conditional E-value: 8.6e-11
      DUF308   1 llGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllll 72 
                 ++G  +++l++la+ + + a+l l++++Gi +++ G++  ++a++     +  r +++++G+++liaG++++
  VIMSS33397  86 ISGAASLILAVLAFRHFGDAVLLLAIWIGIGFIFRGVATTVSAISDPMLPG--RGWSIFVGVISLIAGIVVM 155
                 6899****************************************5555444..448*************986 PP

  == domain 3  score: 32.5 bits;  conditional E-value: 4.5e-12
      DUF308   2 lGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkkn 50 
                 +G++++++Gi++++ P+ ++ +l+l++Gi+l+v G  +i+++fa rk +
  VIMSS33397 143 VGVISLIAGIVVMASPFESIWILALVVGIWLVVIGTCEIASSFAIRKAS 191
                 8******************************************988754 PP



Or compare VIMSS33397 to CDD or PaperBLAST