PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS354328 to PF03729 (DUF308)

VIMSS354328 has 175 amino acids

Query:       DUF308  [M=73]
Accession:   PF03729.13
Description: Short repeat of unknown function (DUF308)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.8e-26   77.3  52.7    2.8e-13   36.3  17.3    3.1  3  VIMSS354328  


Domain annotation for each sequence (and alignments):
>> VIMSS354328  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   35.7  11.8   4.3e-13   4.3e-13       1      73 []      15      87 ..      15      87 .. 0.96
   2 !   36.3  17.3   2.8e-13   2.8e-13       1      73 []      73     145 ..      73     145 .. 0.98
   3 !   30.4   7.7     2e-11     2e-11       4      44 ..     134     174 ..     131     175 .] 0.96

  Alignments for each domain:
  == domain 1  score: 35.7 bits;  conditional E-value: 4.3e-13
       DUF308  1 llGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllllf 73
                 +lGil+++ +++ + +P+  l+a+v++f+i++++ Gi++i+   ++++  + +    ++lGi+ +++G++llf
  VIMSS354328 15 VLGILFVLTALISFQNPAGNLIAIVMVFAIFAIIKGIFEIFVRNRMKELLGYKAYAPIILGIIDILIGVYLLF 87
                 68***************************************99999999999988999*************98 PP

  == domain 2  score: 36.3 bits;  conditional E-value: 2.8e-13
       DUF308   1 llGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllllf 73 
                  +lGi+ i++G+++l++  + +++l ++f+i++l+ +i+++++  +a++ + g++w+ l++ +l +i+G++llf
  VIMSS354328  73 ILGIIDILIGVYLLFNLNIGVAVLPFVFAIWFLFDSIFGLFTLDFAKRVSTGYFWFTLIVDVLGIILGVMLLF 145
                  79**************************************999899*************************98 PP

  == domain 3  score: 30.4 bits;  conditional E-value: 2e-11
       DUF308   4 illivlGilalllPvaallalvllfGilllvsGivqiiaaf 44 
                  +l i+lG+++l++P+ ++l+l++l+G++++++Gi +i+ af
  VIMSS354328 134 VLGIILGVMLLFNPLSSALTLSFLVGFYFMMFGISNIVYAF 174
                  899***********************************999 PP



Or compare VIMSS354328 to CDD or PaperBLAST