PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS535253 to PF03729 (DUF308)

VIMSS535253 has 197 amino acids

Query:       DUF308  [M=73]
Accession:   PF03729.13
Description: Short repeat of unknown function (DUF308)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.7e-29   88.3  44.8    6.8e-16   44.7  20.3    3.1  3  VIMSS535253  


Domain annotation for each sequence (and alignments):
>> VIMSS535253  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   44.7  20.3   6.8e-16   6.8e-16       1      72 [.      28      98 ..      28      99 .. 0.93
   2 !   27.4   7.6   1.8e-10   1.8e-10      19      72 ..     105     156 ..     103     157 .. 0.88
   3 !   39.5   8.7   2.9e-14   2.9e-14       2      50 ..     144     192 ..     143     196 .. 0.93

  Alignments for each domain:
  == domain 1  score: 44.7 bits;  conditional E-value: 6.8e-16
       DUF308  1 llGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllll 72
                 l+Gil+++lG+l+l++P++++l+ ++ fG++ll+ Gi+q++ af+ +  + g+r+l +++G+ +li++ll++
  VIMSS535253 28 LSGILSLALGVLVLVWPGISILVAAVAFGVYLLITGIAQVVFAFSLHV-SAGSRVLLFISGAASLILALLAF 98
                 68******************************************8887.5556899*************987 PP

  == domain 2  score: 27.4 bits;  conditional E-value: 1.8e-10
       DUF308  19 aallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllll 72 
                   a+l l++++Gi +++ G++  i+a++  +  ++   + ++lG+++l+aG+++l
  VIMSS535253 105 YAILLLAIWIGIGFIFRGVATTISAVSDPNLPGR--GWNIFLGVISLLAGIVVL 156
                  58999*********************77765555..48**************98 PP

  == domain 3  score: 39.5 bits;  conditional E-value: 2.9e-14
       DUF308   2 lGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkkn 50 
                  lG++++++Gi++l+ P+ ++++l++++G++++v G+++ii++f  rk +
  VIMSS535253 144 LGVISLLAGIVVLASPFESIVTLAIVVGAWFVVIGVFEIISSFGIRKAS 192
                  8******************************************888755 PP



Or compare VIMSS535253 to CDD or PaperBLAST