PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS865486 to PF03729 (DUF308)

VIMSS865486 has 537 amino acids

Query:       DUF308  [M=73]
Accession:   PF03729.13
Description: Short repeat of unknown function (DUF308)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.3e-13   37.4  27.3    1.7e-10   27.5   2.2    3.9  4  VIMSS865486  


Domain annotation for each sequence (and alignments):
>> VIMSS865486  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.9   0.1      0.12      0.12      32      42 ..     342     352 ..     319     358 .. 0.59
   2 !   20.4   6.7   2.7e-08   2.7e-08       1      72 [.     366     436 ..     366     437 .. 0.87
   3 ?    1.6   4.3      0.02      0.02       6      40 ..     428     462 ..     426     480 .. 0.82
   4 !   27.5   2.2   1.7e-10   1.7e-10       1      50 [.     481     530 ..     481     534 .. 0.91

  Alignments for each domain:
  == domain 1  score: -0.9 bits;  conditional E-value: 0.12
       DUF308  32 llvsGivqiia 42 
                   l+s+i+q+i+
  VIMSS865486 342 SLFSSIWQMIK 352
                  46677777775 PP

  == domain 2  score: 20.4 bits;  conditional E-value: 2.7e-08
       DUF308   1 llGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllll 72 
                  ++G ++++lGi+ l+lP+ al a+  l+++  + +++ qi+ + ++  k ++ + + +++ ++ +++ + l+
  VIMSS865486 366 IVGWIMVILGIISLTLPQYALRAFGALVAFTGIGFSVHQILDTAKTILKDKQ-KNFFIISYLIVFALSVALI 436
                  79***************************************99966655554.4478899999999888876 PP

  == domain 3  score: 1.6 bits;  conditional E-value: 0.02
       DUF308   6 livlGilalllPvaallalvllfGilllvsGivqi 40 
                    +l ++++++  + ++   +++Gi+l++ + v++
  VIMSS865486 428 VFALSVALISNNRLLIFLAHYFLGIFLIIYSYVRL 462
                  678999999999999**************998887 PP

  == domain 4  score: 27.5 bits;  conditional E-value: 1.7e-10
       DUF308   1 llGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkkn 50 
                  +++il+ +lGi+++++P a+   +++++G+ll++ G++++i+ ++a++k+
  VIMSS865486 481 IEAILAFALGIIIIVNPRAFNRQSIIIIGVLLIIYGFFKVIGELFAQRKT 530
                  679**************************************877777655 PP



Or compare VIMSS865486 to CDD or PaperBLAST