PaperBLAST – Find papers about a protein or its homologs

 

Align WP_012534905.1 to PF03729 (DUF308)

WP_012534905.1 has 186 amino acids

Query:       DUF308  [M=73]
Accession:   PF03729.13
Description: Short repeat of unknown function (DUF308)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.4e-24   71.0  29.1    3.2e-16   45.8  12.3    3.1  3  WP_012534905.1  


Domain annotation for each sequence (and alignments):
>> WP_012534905.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   45.8  12.3   3.2e-16   3.2e-16       1      73 []      20      90 ..      20      90 .. 0.92
   2 !   28.2  10.9   9.8e-11   9.8e-11       7      72 ..      82     145 ..      82     146 .. 0.94
   3 !    7.6   0.1   0.00027   0.00027      16      48 ..     150     182 ..     147     186 .] 0.86

  Alignments for each domain:
  == domain 1  score: 45.8 bits;  conditional E-value: 3.2e-16
          DUF308  1 llGillivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllllf 73
                    ++G++ +++G+ a +lPv+a++++++++G lll+ G+vq++++f+ ++ ++ + ++++l++++y+++++++lf
  WP_012534905.1 20 IVGVIVALAGLGATSLPVMAGVTISTIIGTLLLITGLVQVYHTFRIHS-WKEK-LWYVLSALFYIVGAVFILF 90
                    79******************************************7777.5544.57899************98 PP

  == domain 2  score: 28.2 bits;  conditional E-value: 9.8e-11
          DUF308   7 ivlGilalllPvaallalvllfGilllvsGivqiiaafaarkknrggrwlglllGilyliaGllll 72 
                     iv ++++l+ P+  l+++++++ +++++ G++++i +f++r+  ++g    +l+G+l++++G +++
  WP_012534905.1  82 IVGAVFILFKPLEGLMTITTIMIVVMIFNGLTRMIFGFTNRNLPGSGM--VILSGLLSVVIGGYFF 145
                     78899*************************************999985..59**********9998 PP

  == domain 3  score: 7.6 bits;  conditional E-value: 0.00027
          DUF308  16 lPvaallalvllfGilllvsGivqiiaafaark 48 
                     +P ++l+ l +++G+ l++ G   ++ +++ r+
  WP_012534905.1 150 NPEFSLSLLGTFVGVSLIFEGMSFLFIGLRLRN 182
                     7999*****************998888887665 PP



Or compare WP_012534905.1 to CDD or PaperBLAST