PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS148622 to PF03891 (DUF333)

VIMSS148622 has 83 amino acids

Query:       DUF333  [M=48]
Accession:   PF03891.19
Description: Domain of unknown function (DUF333)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      4e-25   74.2   0.0    4.9e-25   74.0   0.0    1.1  1  VIMSS148622  


Domain annotation for each sequence (and alignments):
>> VIMSS148622  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   74.0   0.0   4.9e-25   4.9e-25       1      48 []      31      77 ..      31      77 .. 0.98

  Alignments for each domain:
  == domain 1  score: 74.0 bits;  conditional E-value: 4.9e-25
       DUF333  1 gmaNPAsvyCvqqGGkleivkdadGgqigyCvLpdGerveeWalyrgd 48
                 gm+NPA+vyC+qqGG+l +v++++ g    C+Lp+Ge ++eW+l+r++
  VIMSS148622 31 GMPNPAAVYCEQQGGTLMPVQTPQ-GVRSDCKLPNGEIIDEWTLWRRE 77
                 7***********************.*********************85 PP



Or compare VIMSS148622 to CDD or PaperBLAST