PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5751265 to PF03891 (DUF333)

VIMSS5751265 has 144 amino acids

Query:       DUF333  [M=48]
Accession:   PF03891.19
Description: Domain of unknown function (DUF333)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
      4e-27   80.6   0.2    7.8e-27   79.7   0.2    1.5  1  VIMSS5751265  


Domain annotation for each sequence (and alignments):
>> VIMSS5751265  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   79.7   0.2   7.8e-27   7.8e-27       2      47 ..      32      76 ..      31      77 .. 0.96

  Alignments for each domain:
  == domain 1  score: 79.7 bits;  conditional E-value: 7.8e-27
        DUF333  2 maNPAsvyCvqqGGkleivkdadGgqigyCvLpdGerveeWalyrg 47
                   +NPAs+yCv+qGGklei+++a+ gq++yC+Lp+G++veeW+l+r 
  VIMSS5751265 32 SPNPASQYCVEQGGKLEIRNEAN-GQVDYCHLPNGQVVEEWKLFRD 76
                  58*********************.*********************7 PP



Or compare VIMSS5751265 to CDD or PaperBLAST