PaperBLAST – Find papers about a protein or its homologs

 

Align WP_005463993.1 to PF03891 (DUF333)

WP_005463993.1 has 86 amino acids

Query:       DUF333  [M=48]
Accession:   PF03891.19
Description: Domain of unknown function (DUF333)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.6e-24   72.3   0.2    2.3e-24   71.8   0.2    1.2  1  WP_005463993.1  


Domain annotation for each sequence (and alignments):
>> WP_005463993.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   71.8   0.2   2.3e-24   2.3e-24       2      48 .]      34      79 ..      33      79 .. 0.96

  Alignments for each domain:
  == domain 1  score: 71.8 bits;  conditional E-value: 2.3e-24
          DUF333  2 maNPAsvyCvqqGGkleivkdadGgqigyCvLpdGerveeWalyrgd 48
                    +aNPA+vyCvqqGG+l++v+++   +++yCvL+d erve+W++yr++
  WP_005463993.1 34 VANPAAVYCVQQGGELDTVSENG-ERVTYCVLSDDERVEQWEYYRNN 79
                    79*******************99.*********************86 PP



Or compare WP_005463993.1 to CDD or PaperBLAST