WP_005463993.1 has 86 amino acids
Query: DUF333 [M=48] Accession: PF03891.19 Description: Domain of unknown function (DUF333) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-24 72.3 0.2 2.3e-24 71.8 0.2 1.2 1 WP_005463993.1 Domain annotation for each sequence (and alignments): >> WP_005463993.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.8 0.2 2.3e-24 2.3e-24 2 48 .] 34 79 .. 33 79 .. 0.96 Alignments for each domain: == domain 1 score: 71.8 bits; conditional E-value: 2.3e-24 DUF333 2 maNPAsvyCvqqGGkleivkdadGgqigyCvLpdGerveeWalyrgd 48 +aNPA+vyCvqqGG+l++v+++ +++yCvL+d erve+W++yr++ WP_005463993.1 34 VANPAAVYCVQQGGELDTVSENG-ERVTYCVLSDDERVEQWEYYRNN 79 79*******************99.*********************86 PP
Or compare WP_005463993.1 to CDD or PaperBLAST