PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS156112 to PF04074 (DUF386)

VIMSS156112 has 150 amino acids

Query:       DUF386  [M=148]
Accession:   PF04074.12
Description: YhcH/YjgK/YiaL
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.3e-48  149.6   0.0    3.7e-48  149.4   0.0    1.0  1  VIMSS156112  


Domain annotation for each sequence (and alignments):
>> VIMSS156112  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  149.4   0.0   3.7e-48   3.7e-48       1     147 [.       1     147 [.       1     148 [. 0.96

  Alignments for each domain:
  == domain 1  score: 149.4 bits;  conditional E-value: 3.7e-48
                  -EEEETTSTTTT--HHHHHHHHHHHTS-GCC--SEEEE-.SSS-EEEEE--B-B-GGGS-EEE-SSEEEEEEEEES-EEEEEE-S---GGGS---BTT CS
       DUF386   1 MIidnlenlkrylkpklkkaleylketdlenlpeGkyeidgdklfvnvqeyetkpaeeakfEsHrkyiDiqivleGeErigyaelaekeelkeeydee 98 
                  MI++n+e+l+  l+ +l++a+e+++++ ++++++Gky+idgd+lf++++e+ t+p e++ +E+H +y+Diqivl+G+E +++++  ++ + ++++ ++
  VIMSS156112   1 MIVGNIEHLEAWLPTALRQAIEHVNAHVTATTAPGKYDIDGDRLFYMISENMTEPGESRSAEYHARYLDIQIVLQGQEGMAFSTR-PAGTPHTDWLAD 97 
                  9*******************************************************************************98855.56777779**** PP

                  TTBEEES--TTEEEEEE-TTEEEEE-TT--EEE.....B--B-EEEEEEE CS
       DUF386  99 kDiafyaegeeessvtlkpgdfaiffPedaHrp.eaekekekvkKvVvKv 147
                  kDiaf+ ++ +e++v l++gdf++f+P+++H+p +a++e+++v+K+VvK 
  VIMSS156112  98 KDIAFLPTSVDEKTVVLNEGDFVVFYPGEVHKPlCAVGEPARVRKAVVKM 147
                  *************************************************6 PP



Or compare VIMSS156112 to CDD or PaperBLAST