PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS18277 to PF04074 (DUF386)

VIMSS18277 has 150 amino acids

Query:       DUF386  [M=148]
Accession:   PF04074.12
Description: YhcH/YjgK/YiaL
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    2.6e-49  153.1   0.0    2.9e-49  153.0   0.0    1.0  1  VIMSS18277  


Domain annotation for each sequence (and alignments):
>> VIMSS18277  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  153.0   0.0   2.9e-49   2.9e-49       1     147 [.       1     147 [.       1     148 [. 0.97

  Alignments for each domain:
  == domain 1  score: 153.0 bits;  conditional E-value: 2.9e-49
                 -EEEETTSTTTT--HHHHHHHHHHHTS-GCC--SEEEE-.SSS-EEEEE--B-B-GGGS-EEE-SSEEEEEEEEES-EEEEEE-S---GGGS---BTTT CS
      DUF386   1 MIidnlenlkrylkpklkkaleylketdlenlpeGkyeidgdklfvnvqeyetkpaeeakfEsHrkyiDiqivleGeErigyaelaekeelkeeydeek 99 
                 MIi+n++nl+  l+++l++a+e++k++ ++++p+Gk++i+g++lf++++e+ t+p e +++E+H +y+Diqivl+G+E ++++ ++++ + ++++ ++k
  VIMSS18277   1 MIIGNIHNLQPWLPQELRQAIEHIKAHVTAETPKGKHDIEGNRLFYLISEDMTEPYEARRAEYHARYLDIQIVLKGQEGMTFS-TQPAGAPDTDWLADK 98 
                 9*******************************************************************************888.677888888****** PP

                 TBEEES--TTEEEEEE-TTEEEEE-TT--EEE.....B--B-EEEEEEE CS
      DUF386 100 DiafyaegeeessvtlkpgdfaiffPedaHrp.eaekekekvkKvVvKv 147
                 Diaf+ eg +e++v l++gdf++f+P+++H+p +a++ +++v+K+VvK 
  VIMSS18277  99 DIAFLPEGVDEKTVILNEGDFVVFYPGEVHKPlCAVGAPAQVRKAVVKM 147
                 ************************************************6 PP



Or compare VIMSS18277 to CDD or PaperBLAST