PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2018388 to PF04074 (DUF386)

VIMSS2018388 has 150 amino acids

Query:       DUF386  [M=148]
Accession:   PF04074.12
Description: YhcH/YjgK/YiaL
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.3e-44  137.9   0.0    1.4e-44  137.8   0.0    1.0  1  VIMSS2018388  


Domain annotation for each sequence (and alignments):
>> VIMSS2018388  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  137.8   0.0   1.4e-44   1.4e-44       1     148 []       1     148 [.       1     148 [. 0.93

  Alignments for each domain:
  == domain 1  score: 137.8 bits;  conditional E-value: 1.4e-44
                   -EEEETTSTTTT..--HHHHHHHHHHHTS-GCC--SEEEE-.SSS-EEEEE--B-B-GGGS-EEE-SSEEEEEEEEES-EEEEEE-S---GGGS--- CS
        DUF386   1 MIidnlenlkry..lkpklkkaleylketdlenlpeGkyeidgdklfvnvqeyetkpaeeakfEsHrkyiDiqivleGeErigyaelaekeelkeey 95 
                   MIi+++++l  y  ++p++++++++l++t lenl+eG++ idg++lf n+ +y    ++ a+fE+H+ky+Di++vle eE ++++   e+ ++++ey
  VIMSS2018388   1 MIITKISRLGTYvgVNPHFATLIDFLEKTGLENLTEGSIAIDGNRLFGNCFTYLADGQAGAFFETHQKYLDIHLVLENEEAMAVTS-PENVSVTQEY 96 
                   9***********6666******************************************************************6653.334555669* PP

                   BTTTTBEEES--TTEEEEEE-TTEEEEE-TT--EEE....B--B-EEEEEEEE CS
        DUF386  96 deekDiafyaegeeessvtlkpgdfaiffPedaHrpeaekekekvkKvVvKvk 148
                   deekDi +y +g+ e+ v+l++g+++i fPed+H+p+ + ++e+vkKvV+Kv+
  VIMSS2018388  97 DEEKDIELY-TGKVEQLVHLRAGECLITFPEDLHQPKVRINDEPVKKVVFKVA 148
                   *********.**************************66778889*******95 PP



Or compare VIMSS2018388 to CDD or PaperBLAST