PaperBLAST – Find papers about a protein or its homologs

 

Align NP_014807.3 to PF04190 (DUF410)

NP_014807.3 has 312 amino acids

Query:       DUF410  [M=255]
Accession:   PF04190.13
Description: Protein of unknown function (DUF410)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.8e-84  269.0   1.7    3.5e-84  268.6   1.7    1.1  1  NP_014807.3  


Domain annotation for each sequence (and alignments):
>> NP_014807.3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  268.6   1.7   3.5e-84   3.5e-84       1     255 []      46     308 ..      46     308 .. 0.95

  Alignments for each domain:
  == domain 1  score: 268.6 bits;  conditional E-value: 3.5e-84
       DUF410   1 qkkydeAidllyqgalellkakqygsgaDLalllvevyekaevevdeeskdrliellskfpaeeperkkfikaaikwSakkgekkaGdpeLhhllakl 98 
                  +k+y++Ai+l+ qgal++lkakq+gsg+DL+++l+evy+ aev+vd+ s++rl++l+++++++ep++k++i+ +++wS k++e+k+Gdp+Lh+ ++++
  NP_014807.3  46 SKSYEHAIELISQGALSFLKAKQGGSGTDLIFYLLEVYDLAEVKVDDISVARLVRLIAELDPSEPNLKDVITGMNNWSIKFSEYKFGDPYLHNTIGSK 143
                  589*********************************************************************************************** PP

       DUF410  99 llkegeleeAerhlllgtddsaeelakllvewaee...geeseadlfiaRavLqylllgnvkaAnklldeflkkleskessll.......te.rvfp. 184
                  ll+ + ++eAer+++lgt+ds+ ++++ll++w+ +    e+s+++ f++R+v++yl++ n+++A ++ d fl+++ +k++++        +e  +f+ 
  NP_014807.3 144 LLEGDFVYEAERYFMLGTHDSMIKYVDLLWDWLCQvddIEDSTVAEFFSRLVFNYLFISNISFAHESKDIFLERFIEKFHPKYekidkngYEiVFFEd 241
                  ***888888**************************75433459************************************998899987654479999* PP

       DUF410 185 lpllnFlqlllltiqrkskelFkkLkekYkpslkrdpslkeylekIgelyFgikpprqqsnglqdmmssLl 255
                  ++ lnFlqlll+t+q+k+k+ F +Lk++Y +  ++   +k+ le +g++yF+i +p+q  n+lqdmms++l
  NP_014807.3 242 YSDLNFLQLLLITCQTKDKSYFLNLKNHYLDFSQA---YKSELEFLGQEYFNIVAPKQ-TNFLQDMMSGFL 308
                  *****************************987777...99*****************9.8*********97 PP



Or compare NP_014807.3 to CDD or PaperBLAST