PaperBLAST – Find papers about a protein or its homologs

 

Align Q12125 to PF04190 (DUF410)

Q12125 has 312 amino acids

Query:       DUF410  [M=255]
Accession:   PF04190.13
Description: Protein of unknown function (DUF410)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.8e-84  269.0   1.7    3.5e-84  268.6   1.7    1.1  1  Q12125    


Domain annotation for each sequence (and alignments):
>> Q12125  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  268.6   1.7   3.5e-84   3.5e-84       1     255 []      46     308 ..      46     308 .. 0.95

  Alignments for each domain:
  == domain 1  score: 268.6 bits;  conditional E-value: 3.5e-84
  DUF410   1 qkkydeAidllyqgalellkakqygsgaDLalllvevyekaevevdeeskdrliellskfpaeeperkkfikaaikwSakkgekkaGdpeLhhllaklllkeg 103
             +k+y++Ai+l+ qgal++lkakq+gsg+DL+++l+evy+ aev+vd+ s++rl++l+++++++ep++k++i+ +++wS k++e+k+Gdp+Lh+ ++++ll+ +
  Q12125  46 SKSYEHAIELISQGALSFLKAKQGGSGTDLIFYLLEVYDLAEVKVDDISVARLVRLIAELDPSEPNLKDVITGMNNWSIKFSEYKFGDPYLHNTIGSKLLEGD 148
             589**************************************************************************************************88 PP

  DUF410 104 eleeAerhlllgtddsaeelakllvewaee...geeseadlfiaRavLqylllgnvkaAnklldeflkkleskessll.......te.rvfp.lpllnFlqll 194
              ++eAer+++lgt+ds+ ++++ll++w+ +    e+s+++ f++R+v++yl++ n+++A ++ d fl+++ +k++++        +e  +f+ ++ lnFlqll
  Q12125 149 FVYEAERYFMLGTHDSMIKYVDLLWDWLCQvddIEDSTVAEFFSRLVFNYLFISNISFAHESKDIFLERFIEKFHPKYekidkngYEiVFFEdYSDLNFLQLL 251
             8888**************************75433459************************************998899987654479999*********** PP

  DUF410 195 lltiqrkskelFkkLkekYkpslkrdpslkeylekIgelyFgikpprqqsnglqdmmssLl 255
             l+t+q+k+k+ F +Lk++Y +  ++   +k+ le +g++yF+i +p+q  n+lqdmms++l
  Q12125 252 LITCQTKDKSYFLNLKNHYLDFSQA---YKSELEFLGQEYFNIVAPKQ-TNFLQDMMSGFL 308
             *******************987777...99*****************9.8*********97 PP



Or compare Q12125 to CDD or PaperBLAST