PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::O74432 to PF04190 (DUF410)

SwissProt::O74432 has 303 amino acids

Query:       DUF410  [M=255]
Accession:   PF04190.13
Description: Protein of unknown function (DUF410)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    2.2e-72  230.0   0.7    2.6e-72  229.8   0.7    1.0  1  SwissProt::O74432  


Domain annotation for each sequence (and alignments):
>> SwissProt::O74432  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  229.8   0.7   2.6e-72   2.6e-72       1     255 []      33     290 ..      33     290 .. 0.97

  Alignments for each domain:
  == domain 1  score: 229.8 bits;  conditional E-value: 2.6e-72
             DUF410   1 qkkydeAidllyqgalellkakqygsgaDLalllvevyekaevevdeeskdrliellskfpaeeperkkfikaaikwSakkgekkaGdpeLh 92 
                        +kk+d+A++lly+ga++l++ +q gs+aDLa+++++vyeka    + ++k+r ++ll +fpaee +rk+++k+ ++wS++ g  ++Gd++ h
  SwissProt::O74432  33 AKKHDDAVALLYSGAKTLFEIEQTGSAADLAIYMLDVYEKASYAASLDNKARALTLLGLFPAEEGARKQYVKRLLEWSKSAG--PQGDKDVH 122
                        599******************************************************************************9..9******* PP

             DUF410  93 hllaklllkegeleeAerhlllgtddsaeelakllvewaeegeeseadlfiaRavLqylllgnvkaAnklldeflkkleskessll...... 178
                         ++a++++k +e   Ae+h++lg+++sa+++++ ++ w++++++   d+f+ R vL+yll++n+  A ++l++f+k++++++++        
  SwissProt::O74432 123 FAVATMFVKWKEPASAEKHFVLGNEKSARAYGETMYYWFTSDSSISPDTFAGRPVLNYLLAENLISAWNSLETFTKHFTKSNAPDVenmsfd 214
                        *****************************************99999*************************************988999998 PP

             DUF410 179 .te.rvfp.lpllnFlqlllltiqrkskelFkkLkekYkpslkrdpslkeylekIgelyFgikpprqqsnglqdmmssLl 255
                         ++ +vf+ +p +nFl+ll+ t  rk+ke++ +L++kY ++    + ++++l+kI+e+yFgi+p ++q n l+++mssL+
  SwissProt::O74432 215 gKDfPVFKeYPQMNFLHLLIFTAYRKDKETYLSLVQKYPKK----QDWEAALAKIEEIYFGIRPVSNQPNILANLMSSLF 290
                        6337**********************************983....44899*****************************9 PP



Or compare SwissProt::O74432 to CDD or PaperBLAST