NP_418213.1 has 112 amino acids
Query: DUF413 [M=90] Accession: PF04219.16 Description: Protein of unknown function, DUF Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-42 129.7 0.1 1.9e-42 129.5 0.1 1.0 1 NP_418213.1 Domain annotation for each sequence (and alignments): >> NP_418213.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 129.5 0.1 1.9e-42 1.9e-42 1 88 [. 10 97 .. 10 99 .. 0.98 Alignments for each domain: == domain 1 score: 129.5 bits; conditional E-value: 1.9e-42 DUF413 1 rFyDdknfprGfsrsGdFtikeaelLeqyGqalkaLeegelepvteeekqfvevvkgekaaeselekvWlkYlklirgkkrfhtlvgt 88 r++D+k++prGfsr+GdFtikea+lLe++G+a+++L+ g++epvteeek fv+v++ge+++ +e+e+vW+kY+ +i+++krfhtl+g NP_418213.1 10 RYFDNKHYPRGFSRHGDFTIKEAQLLERHGYAFNELDLGKREPVTEEEKLFVAVCRGEREPVTEAERVWSKYMTRIKRPKRFHTLSGG 97 79***********************************************************************************986 PP
Or compare NP_418213.1 to CDD or PaperBLAST