VIMSS147183 has 112 amino acids
Query: DUF413 [M=90] Accession: PF04219.16 Description: Protein of unknown function, DUF Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-43 131.2 0.1 6.6e-43 130.9 0.1 1.0 1 VIMSS147183 Domain annotation for each sequence (and alignments): >> VIMSS147183 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 130.9 0.1 6.6e-43 6.6e-43 1 88 [. 10 97 .. 10 99 .. 0.98 Alignments for each domain: == domain 1 score: 130.9 bits; conditional E-value: 6.6e-43 DUF413 1 rFyDdknfprGfsrsGdFtikeaelLeqyGqalkaLeegelepvteeekqfvevvkgekaaeselekvWlkYlklirgkkrfhtlvgt 88 rF+D+k++prGfsr+GdFtikea+lLe++G+a+++L++g++epvteee++fv+v++ge+++ s+ ekvW+kY+ ++r++krfhtl+g VIMSS147183 10 RFFDNKHYPRGFSRHGDFTIKEAQLLERHGYAFNELDSGKREPVTEEEQRFVAVCRGEREPVSAEEKVWSKYVIRTRQPKRFHTLSGG 97 8************************************************************************************986 PP
Or compare VIMSS147183 to CDD or PaperBLAST