WP_000264715.1 has 121 amino acids
Query: DUF423 [M=87]
Accession: PF04241.19
Description: Protein of unknown function (DUF423)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-31 94.8 3.5 2.5e-31 94.1 3.5 1.4 1 WP_000264715.1
Domain annotation for each sequence (and alignments):
>> WP_000264715.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 94.1 3.5 2.5e-31 2.5e-31 1 87 [] 16 102 .. 16 102 .. 0.98
Alignments for each domain:
== domain 1 score: 94.1 bits; conditional E-value: 2.5e-31
DUF423 1 lGAfGaHglkkkleeeqlevfetavqYqlyhalallavallaeaaaakllklagllflaGivlFSgslyllaltgdkllgaitPiGG 87
lGAfGaHglk+ +++eql++++ta+ Y +yhal+lla+++l++ +kl++ll+ +Gi++F+gsly++al ++lgaitPiGG
WP_000264715.1 16 LGAFGAHGLKAHASPEQLAWWQTATDYFFYHALGLLALGILSKVLPHFPIKLSFLLIQIGILFFCGSLYIMALGLPRILGAITPIGG 102
7*********99999**************************99999999************************999**********9 PP
Or compare WP_000264715.1 to CDD or PaperBLAST