PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10490627 to PF04285 (DUF444)

VIMSS10490627 has 423 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
   1.1e-183  597.1   0.1   1.2e-183  596.9   0.1    1.0  1  VIMSS10490627  


Domain annotation for each sequence (and alignments):
>> VIMSS10490627  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  596.9   0.1  1.2e-183  1.2e-183       2     420 ..       4     419 ..       3     420 .. 0.99

  Alignments for each domain:
  == domain 1  score: 596.9 bits;  conditional E-value: 1.2e-183
         DUF444   2 iidrrlngknkslenrqRflrrvkeqikeavadavsersikdiskgekikipikdikepefeygkggeregVlpGnkefkeGdkierpeegggggg 97 
                    +idrrlngknks++nrqRflrr++++ik+av++avs+rsi+d+++ge+i+ip +di+ep +++g+gg+++ V+pGnkef++G++i+rp++gggg+g
  VIMSS10490627   4 VIDRRLNGKNKSTVNRQRFLRRYRDHIKKAVEEAVSRRSITDMEHGEQISIPGRDIDEPVLHHGRGGKQTVVHPGNKEFTAGEHIARPPGGGGGRG 99 
                    79********************************************************************************************** PP

         DUF444  98 sgegseaGegedefefelsreEfldllfedLeLPdLekkklekveekktkragytrkGspsnldvkrtlrealkRrialkrpkeeelreleeelae 193
                     g+ +++Geg+def+f++++eEfl+++fedLeLP+L+k++l+ ++++kt rag++++G+ps++++ rtlr+a++Rrial+ +++++lre++eela+
  VIMSS10490627 100 PGKAGNSGEGMDEFVFQITQEEFLEFMFEDLELPNLVKRNLTGTDTFKTVRAGISNEGNPSRINIIRTLRSAHARRIALSGSSRAKLREVKEELAR 195
                    **99******************************************************************************************** PP

         DUF444 194 leaeeeekeseeleeleeeieeleerikripfidelDlRYrrvekepkpesnaVmfclmDvSGSMdetkkdlakrfFilLylFLkrkYekvevvFi 289
                    l++ee  ++  ++++le+eie+l++ri+r+pf+d++Dl+Y+  +k+p+p+s+aVmfclmDvSGSM++++kd+akrfFilLylFLkr+Y+k++vvFi
  VIMSS10490627 196 LKREEP-DNFGDIQDLEAEIERLSARIHRVPFLDTFDLKYNLLVKQPNPSSKAVMFCLMDVSGSMTQATKDIAKRFFILLYLFLKRNYDKIDVVFI 290
                    ***988.55559************************************************************************************ PP

         DUF444 290 rHtteAkeVdeeeFFysresGGTvvSsalelmkeiieerYppseWNiYaaqasDgdnwseDsekavellaekilplvqyfaYveitpsaseeeqtl 385
                    rH+t+A+eVdeeeFFysre+GGT+vSsal+lm+ei++erYp++eWNiYaaqasDgdnw++Ds+ ++++l ++i+p vqy++Yveitp   +e+q+l
  VIMSS10490627 291 RHHTSAREVDEEEFFYSRETGGTIVSSALKLMQEIMAERYPSNEWNIYAAQASDGDNWNDDSPICRDILINQIMPFVQYYTYVEITP---REHQAL 383
                    ***************************************************************************************...****** PP

         DUF444 386 weeyekvaeee.enfamakvkekediypvfrellkk 420
                    w+eye++ae++ ++fa +++ ++ diypvfrel+++
  VIMSS10490627 384 WYEYERIAEAFsDTFAQQQLVSAGDIYPVFRELFQR 419
                    **********99**********************98 PP



Or compare VIMSS10490627 to CDD or PaperBLAST