PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS118217 to PF04285 (DUF444)

VIMSS118217 has 391 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   7.3e-130  419.8  15.9    2.7e-81  259.8   2.4    2.0  2  VIMSS118217  


Domain annotation for each sequence (and alignments):
>> VIMSS118217  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  165.7   6.4   9.6e-53   9.6e-53       2     183 ..       4     185 ..       3     190 .. 0.95
   2 !  259.8   2.4   2.7e-81   2.7e-81     217     421 .]     189     388 ..     184     388 .. 0.98

  Alignments for each domain:
  == domain 1  score: 165.7 bits;  conditional E-value: 9.6e-53
       DUF444   2 iidrrlng..knkslenrqRflrrvkeqikeavadavsersikdiskgekikipikdikepefeygkggeregVlpGnkefkeGdkierpeegggggg 97 
                  ++d++ n+  +++++ +r+R+++ v+++ik+++ad+vse+si+++sk++kikipi+++ke++f yg  ++++ V++G++++k+Gd i++++ g+g++g
  VIMSS118217   4 FRDYSINPteHDRTIGDRRRHRELVEKAIKDNLADIVSEESIIGESKSKKIKIPIRGLKEYKFLYG--NNSSSVGSGTGNEKKGDIIGKEQMGNGSKG 99 
                  78888888779*******************************************************..99**************************** PP

       DUF444  98 sgegseaGegedefefelsreEfldllfedLeLPdLekkk.lekveekktkragytrkGspsnldvkrtlrealkRrialkrpkeee 183
                  +g+g  + eged +e+e++ eE++++l+edL+LP+L+kkk +e v+++++k+agy++ G++++l++krt+ e++kR ++ kr + +e
  VIMSS118217 100 KGKGAGNSEGEDIYETEVTIEEVFSYLLEDLNLPNLDKKKySEIVTDSSKKKAGYQKYGIRPRLAKKRTVIEKIKREQSRKR-AIKE 185
                  *9999999********************************899999********************************9999.4444 PP

  == domain 2  score: 259.8 bits;  conditional E-value: 2.7e-81
       DUF444 217 eerikripfidelDlRYrrvekepkpesnaVmfclmDvSGSMdetkkdlakrfFilLylFLkrkYekvevvFirHtteAkeVdeeeFFysresGGTvv 314
                  +++++r+pf +e DlRY+r++++pk+e na ++c+mD+SGSMd+tkk+la++fF++L+ F+++kY +ve++Fi+H+t  +eV+e+eFF++ esGGT++
  VIMSS118217 189 DDKVERLPFSEE-DLRYHRIKEKPKKECNAAIMCVMDCSGSMDSTKKYLARSFFFILSKFIRMKYVNVEIAFISHSTVGREVTETEFFHKVESGGTYI 285
                  5789********.************************************************************************************* PP

       DUF444 315 SsalelmkeiieerYppseWNiYaaqasDgdnwseDsekavellaekilplvqyfaYveitpsaseeeqtlweeyekvaeeeenfamakvkekediyp 412
                  Ss+l+++ +ii+er++p++WNiY++++sDgdn++eD e+a++  ++k ++++++ +Y+ei p  ++++ t+++++++++++ +nf  +++++ked++p
  VIMSS118217 286 SSGLNTAMDIIKERFNPATWNIYGFYVSDGDNFTEDDERAIK-SMRKFCEIANMIGYAEILP--YSYSGTMKYKFDNYVKD-KNFISSTIRNKEDLWP 379
                  ******************************************.9999***************..9***************5.**************** PP

       DUF444 413 vfrellkke 421
                  v++++l ke
  VIMSS118217 380 VLKKMLIKE 388
                  *****9875 PP



Or compare VIMSS118217 to CDD or PaperBLAST