PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS124073 to PF04285 (DUF444)

VIMSS124073 has 438 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   7.2e-170  551.6   0.0   8.1e-170  551.4   0.0    1.0  1  VIMSS124073  


Domain annotation for each sequence (and alignments):
>> VIMSS124073  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  551.4   0.0  8.1e-170  8.1e-170       2     421 .]       4     431 ..       3     431 .. 0.97

  Alignments for each domain:
  == domain 1  score: 551.4 bits;  conditional E-value: 8.1e-170
       DUF444   2 iidrrlngknkslenrqRflrrvkeqikeavadavsersikdiskgekikipikdikepefeyg.kggeregVlpGnkefkeGdkierpeeggggggs 98 
                  +idrrln+k+ksl nrqRfl+r++e++k+ +++ v++++i d++ ++++++p+++++ep f+ + ++ger++VlpGn+ef++Gd+i +  +ggg g+ 
  VIMSS124073   4 FIDRRLNPKDKSLGNRQRFLKRAREELKRTIKERVKSGKIADVDAEQNVSMPARGVNEPAFQPDsNSGERRHVLPGNREFAAGDRIPKRGSGGGAGN- 100
                  9***************************************************************999*******************99877766654. PP

       DUF444  99 gegseaGegedefefelsreEfldllfedLeLPdLekkklekveekktkragytrkGspsnldvkrtlrealkRrialkrpkeeelreleeelaelea 196
                   +g  +G++edef+f lsreE+ldl+fedLeLPd++k +l++  ++k +rag++++Gsp+n++v rt+r+++ Rrial+rp+++e+++l +e+a le+
  VIMSS124073 101 -AGAGTGQSEDEFQFVLSREEVLDLFFEDLELPDMVKLNLKESVTFKRRRAGFSASGSPTNINVGRTMRNSYGRRIALRRPSRREIEALADEIAGLET 197
                  .45789******************************************************************************************** PP

       DUF444 197 eeee..keseeleeleeeieeleerikripfidelDlRYrrvekepkpesnaVmfclmDvSGSMdetkkdlakrfFilLylFLkrkYekvevvFirHt 292
                  e ++  k++++leel++++++le+r++rip++d++D+R++r+e +p p+++aVmfclmDvS SM e++kdlakrfF+lL+lFLkr+Ye++++vFirHt
  VIMSS124073 198 EPRGriKHRQRLEELRQKLDRLERRRRRIPYVDPVDIRFNRFEPQPLPNASAVMFCLMDVSASMGEREKDLAKRFFVLLHLFLKRRYERIDIVFIRHT 295
                  98844577889*************************************************************************************** PP

       DUF444 293 teAkeVdeeeFFysresGGTvvSsalelmkeiieerYppseWNiYaaqasDgdnwseDsekavellaekilplvqyfaYveitp.......saseeeq 383
                  +eA eVde++FFys++sGGTvvS+ale+m ++i+erYp++eWNiYaaqasDg+n+s Dse++++ll+++++ l+qy+aYvei +       +++++ +
  VIMSS124073 296 DEAGEVDENTFFYSKQSGGTVVSTALEEMLRVIRERYPAHEWNIYAAQASDGENISGDSERCASLLHDELMGLCQYYAYVEIIDereteifGTTDNGT 393
                  ***********************************************************************************999999999999*** PP

       DUF444 384 tlweeyekvaeeeenfamakvkekediypvfrellkke 421
                  +lw++y++v  e++nf+m+++++++diypvfr+l+ k+
  VIMSS124073 394 SLWRAYRTVDGEWPNFQMTRIAKPADIYPVFRKLFGKQ 431
                  ***********************************886 PP



Or compare VIMSS124073 to CDD or PaperBLAST