PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS148631 to PF04285 (DUF444)

VIMSS148631 has 428 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   3.6e-190  618.5   2.7     4e-190  618.3   2.7    1.0  1  VIMSS148631  


Domain annotation for each sequence (and alignments):
>> VIMSS148631  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  618.3   2.7    4e-190    4e-190       2     421 .]       4     422 ..       3     422 .. 0.97

  Alignments for each domain:
  == domain 1  score: 618.3 bits;  conditional E-value: 4e-190
       DUF444   2 iidrrlngknkslenrqRflrrvkeqikeavadavsersikdiskgekikipikdikepefeygkggeregVlpGnkefkeGdkierpeegggggg.s 98 
                  +idrrlngknks++nrqRflrr+k+qik+++++a+++rs++d+++ge+++ip++di+ep f++g+gg r++V+pGn++f + d+ierp++ggggg+ s
  VIMSS148631   4 FIDRRLNGKNKSTVNRQRFLRRYKAQIKQSISEAINKRSVTDVDSGESVSIPTDDISEPMFHQGRGGLRHRVHPGNDHFIQNDRIERPQGGGGGGSgS 101
                  8****************************************************************************************987664324 PP

       DUF444  99 geg..seaGegedefefelsreEfldllfedLeLPdLekkklekveekktkragytrkGspsnldvkrtlrealkRrialkrpkeeelreleeelael 194
                  g+g  s++Geg+def+f++s++E+ldllfedL+LP+L+k++ ++++e+kt+rag+t++G+p+n++v+r+l+++l+Rr+a++++k++el++le+el+++
  VIMSS148631 102 GQGqaSQDGEGQDEFVFQISKDEYLDLLFEDLALPNLKKNQHRQLNEYKTHRAGFTSNGVPANISVVRSLQNSLARRTAMTAGKRRELHALETELETI 199
                  4446699******************************************************************************************* PP

       DUF444 195 eaeeeekeseeleeleeeieeleerikripfidelDlRYrrvekepkpesnaVmfclmDvSGSMdetkkdlakrfFilLylFLkrkYekvevvFirHt 292
                   ++e  ++  e+e+l++ei+el+++i+r+pfid++DlRY+++ek+p+p+s+aVmfclmDvSGSMd+++kd+akrf+ilLylFL+r+Y++vevv+irH+
  VIMSS148631 200 SHSEP-AQLLEEERLRREIAELRAKIERVPFIDTFDLRYKNYEKRPEPSSQAVMFCLMDVSGSMDQATKDMAKRFYILLYLFLSRTYKNVEVVYIRHH 296
                  99977.666699************************************************************************************** PP

       DUF444 293 teAkeVdeeeFFysresGGTvvSsalelmkeiieerYppseWNiYaaqasDgdnwseDsekavellaekilplvqyfaYveitpsaseeeqtlweeye 390
                  t+AkeVde+eFFys+e+GGT+vSsal+lm+e+++erY+p +WNiYaaqasDgdnw++Ds+ + e+la+k+lp+v+y++Y+eit+   +++qtlw+eye
  VIMSS148631 297 TQAKEVDEHEFFYSQETGGTIVSSALKLMDEVVKERYDPGQWNIYAAQASDGDNWADDSPLCHEILAKKLLPVVRYYSYIEITR---RAHQTLWREYE 391
                  ************************************************************************************...*********** PP

       DUF444 391 kvaeeeenfamakvkekediypvfrellkke 421
                  +++++++nfam++++++ediypvfrel++k+
  VIMSS148631 392 HLQATFDNFAMQHIRDQEDIYPVFRELFQKQ 422
                  *****************************96 PP



Or compare VIMSS148631 to CDD or PaperBLAST