PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS15902 to PF04285 (DUF444)

VIMSS15902 has 427 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
   1.5e-190  619.7   3.2   1.7e-190  619.5   3.2    1.0  1  VIMSS15902  


Domain annotation for each sequence (and alignments):
>> VIMSS15902  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  619.5   3.2  1.7e-190  1.7e-190       2     421 .]       4     421 ..       3     421 .. 0.99

  Alignments for each domain:
  == domain 1  score: 619.5 bits;  conditional E-value: 1.7e-190
      DUF444   2 iidrrlngknkslenrqRflrrvkeqikeavadavsersikdiskgekikipikdikepefeygkggeregVlpGnkefkeGdkierpeeggggggsge 100
                 +idrrlngknks++nrqRflrr+k+qik+++++a+++rs++d+++ge+++ip++di+ep f++g+gg r++V+pGn++f++ d+ierp++gggg+gsg+
  VIMSS15902   4 FIDRRLNGKNKSMVNRQRFLRRYKAQIKQSISEAINKRSVTDVDSGESVSIPTEDISEPMFHQGRGGLRHRVHPGNDHFVQNDRIERPQGGGGGSGSGQ 102
                 8*********************************************************************************************99998 PP

      DUF444 101 g..seaGegedefefelsreEfldllfedLeLPdLekkklekveekktkragytrkGspsnldvkrtlrealkRrialkrpkeeelreleeelaeleae 197
                 g  s++Geg+def+f++s++E+ldllfedL+LP+L+++++++++e+kt+ragyt++G+p+n++v+r+l+++l+Rr+a++++k++el++lee+la + ++
  VIMSS15902 103 GqaSQDGEGQDEFVFQISKDEYLDLLFEDLALPNLKQNQQRQLTEYKTHRAGYTANGVPANISVVRSLQNSLARRTAMTAGKRRELHALEENLAIISNS 201
                 88899******************************************************************************************9998 PP

      DUF444 198 eeekeseeleeleeeieeleerikripfidelDlRYrrvekepkpesnaVmfclmDvSGSMdetkkdlakrfFilLylFLkrkYekvevvFirHtteAk 296
                 e  ++  e+e+l++ei+el+++i+r+pfid++DlRY+++ek+p p+s+aVmfclmDvSGSMd+++kd+akrf+ilLylFL+r+Y++vevv+irH+t+Ak
  VIMSS15902 202 EP-AQLLEEERLRKEIAELRAKIERVPFIDTFDLRYKNYEKRPDPSSQAVMFCLMDVSGSMDQSTKDMAKRFYILLYLFLSRTYKNVEVVYIRHHTQAK 299
                 77.666699****************************************************************************************** PP

      DUF444 297 eVdeeeFFysresGGTvvSsalelmkeiieerYppseWNiYaaqasDgdnwseDsekavellaekilplvqyfaYveitpsaseeeqtlweeyekvaee 395
                 eVde+eFFys+e+GGT+vSsal+lm+e+++erY+p++WNiYaaqasDgdnw++Ds+ + e+la+k+lp+v+y++Y+eit+   +++qtlw+eye+++++
  VIMSS15902 300 EVDEHEFFYSQETGGTIVSSALKLMDEVVKERYNPAQWNIYAAQASDGDNWADDSPLCHEILAKKLLPVVRYYSYIEITR---RAHQTLWREYEHLQST 395
                 ********************************************************************************...**************** PP

      DUF444 396 eenfamakvkekediypvfrellkke 421
                 ++nfam+++++++diypvfrel++k+
  VIMSS15902 396 FDNFAMQHIRDQDDIYPVFRELFHKQ 421
                 ***********************996 PP



Or compare VIMSS15902 to CDD or PaperBLAST