PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1802076 to PF04285 (DUF444)

VIMSS1802076 has 392 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
   7.8e-129  416.4  21.6    7.3e-84  268.3   5.8    2.0  2  VIMSS1802076  


Domain annotation for each sequence (and alignments):
>> VIMSS1802076  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  155.0   8.7   1.8e-49   1.8e-49       2     186 ..       4     185 ..       3     189 .. 0.93
   2 !  268.3   5.8   7.3e-84   7.3e-84     217     421 .]     186     385 ..     178     385 .. 0.97

  Alignments for each domain:
  == domain 1  score: 155.0 bits;  conditional E-value: 1.8e-49
        DUF444   2 iidrrlng..knkslenrqRflrrvkeqikeavadavsersikdiskgekikipikdikepefeygkggeregVlpGnkefkeGdkierpeeggggg 96 
                   ++d+  n+  +++s+e+r+R+++ v+++ike++ d++se+si++++k++k kipi++ike++f yg   +++gV++G++e+++Gd+i+++++++ ++
  VIMSS1802076   4 FRDQAENHveHDRSIEDRRRHRQLVEKSIKENLGDILSEESIIGETKNKKYKIPIRGIKEYQFIYG--ANNKGVTTGTGEESRGDRISSDKRKAISN 98 
                   7888888777********************************************************..99******************999887765 PP

        DUF444  97 gsgegseaGegedefefelsreEfldllfedLeLPdLekkk.lekveekktkragytrkGspsnldvkrtlrealkRrialkrpkeeelre 186
                   +   +  + eg+d +e+e++ eE++d+++edL+LP+L+kkk +e + e++ k++gy++ G++++l++k+t++ +++R+++ kr + +e+ e
  VIMSS1802076  99 N---KAGNQEGKDIYETEITLEELMDYIVEDLDLPNLDKKKySEIIVESAAKKRGYQKYGVRPRLAKKKTVMCKIARKQGKKR-ALREIGE 185
                   4...345569*******************************89999************************************9.6777665 PP

  == domain 2  score: 268.3 bits;  conditional E-value: 7.3e-84
        DUF444 217 eerikripfidelDlRYrrvekepkpesnaVmfclmDvSGSMdetkkdlakrfFilLylFLkrkYekvevvFirHtteAkeVdeeeFFysresGGTv 313
                   e++i r+pf+++ DlRY++v+k+pk+esnaVm+++mDvSGSMd+tkk+la++fF++L++F++rkY++v + Fi+Htt+Ak+V+e eFF++ esGGT+
  VIMSS1802076 186 EAKIGRFPFRED-DLRYYKVKKHPKKESNAVMIFIMDVSGSMDNTKKYLARSFFFVLSRFIRRKYNNVAFEFISHTTTAKNVNEYEFFHKGESGGTY 281
                   68999*******.************************************************************************************ PP

        DUF444 314 vSsalelmkeiieerYppseWNiYaaqasDgdnwseDsekavellaekilplvqyfaYveitpsaseeeqtlweeyekvaeeeenfamakvkekedi 410
                   +Ss+++ + ++i+e+Y+p  WNiY ++asDgdnwseD+eka+e + ++i +l+++f+Y+e+ p  s++++t+ ++++k++++ enf+  +vkek+d+
  VIMSS1802076 282 ISSGINAAIDLIKEKYNPGVWNIYPFYASDGDNWSEDNEKAME-AVNEISDLSNMFGYIELLP--STYSTTMFYRFKKEISK-ENFVSVTVKEKKDL 374
                   *******************************************.8999***************..999*************6.************** PP

        DUF444 411 ypvfrellkke 421
                   +++++ +l++e
  VIMSS1802076 375 WNAIKYMLSEE 385
                   *******9975 PP



Or compare VIMSS1802076 to CDD or PaperBLAST