PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS303965 to PF04285 (DUF444)

VIMSS303965 has 427 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
     1e-190  620.3   3.4   1.2e-190  620.1   3.4    1.0  1  VIMSS303965  


Domain annotation for each sequence (and alignments):
>> VIMSS303965  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  620.1   3.4  1.2e-190  1.2e-190       2     421 .]       4     421 ..       3     421 .. 0.99

  Alignments for each domain:
  == domain 1  score: 620.1 bits;  conditional E-value: 1.2e-190
       DUF444   2 iidrrlngknkslenrqRflrrvkeqikeavadavsersikdiskgekikipikdikepefeygkggeregVlpGnkefkeGdkierpeeggggggsg 99 
                  +idrrlngknks++nrqRflrr+k+qik+++++a+++rs++d+++ge+++ip++di+ep f++g+gg r++V+pGn++f++ d+ierp++gggg+gsg
  VIMSS303965   4 FIDRRLNGKNKSMVNRQRFLRRYKAQIKQSISEAINKRSVTDVDSGESVSIPTEDISEPMFHQGRGGLRHRVHPGNDHFVQNDRIERPQGGGGGSGSG 101
                  8*********************************************************************************************9999 PP

       DUF444 100 eg..seaGegedefefelsreEfldllfedLeLPdLekkklekveekktkragytrkGspsnldvkrtlrealkRrialkrpkeeelreleeelaele 195
                  +g  s++Geg+def+f++s++E+ldllfedL+LP+L+++++++++e+kt+ragyt++G+p+n++v+r+l+++l+Rr+a++++k++el++lee+la + 
  VIMSS303965 102 QGqaSQDGEGQDEFVFQISKDEYLDLLFEDLALPNLKQNQQRQLTEYKTHRAGYTANGVPANISVVRSLQNSLARRTAMTAGKRRELHALEENLAIIS 199
                  888899******************************************************************************************99 PP

       DUF444 196 aeeeekeseeleeleeeieeleerikripfidelDlRYrrvekepkpesnaVmfclmDvSGSMdetkkdlakrfFilLylFLkrkYekvevvFirHtt 293
                  ++e  ++  e+e+l++ei+el+++i+r+pfid++DlRY+++ek+p p+s+aVmfclmDvSGSMd+++kd+akrf+ilLylFL+r+Y++vevv+irH+t
  VIMSS303965 200 NSEP-AQLLEEERLRKEIAELRAKIERVPFIDTFDLRYKNYEKRPDPSSQAVMFCLMDVSGSMDQSTKDMAKRFYILLYLFLSRTYKNVEVVYIRHHT 296
                  9877.666699*************************************************************************************** PP

       DUF444 294 eAkeVdeeeFFysresGGTvvSsalelmkeiieerYppseWNiYaaqasDgdnwseDsekavellaekilplvqyfaYveitpsaseeeqtlweeyek 391
                  +AkeVde+eFFys+e+GGT+vSsal+lm+e+++erY+p++WNiYaaqasDgdnw++Ds+ + e+la+kilp+v+y++Y+eit+   +++qtlw+eye+
  VIMSS303965 297 QAKEVDEHEFFYSQETGGTIVSSALKLMDEVVKERYNPAQWNIYAAQASDGDNWADDSPLCHEILAKKILPVVRYYSYIEITR---RAHQTLWREYEH 391
                  ***********************************************************************************...************ PP

       DUF444 392 vaeeeenfamakvkekediypvfrellkke 421
                  ++++++nfam+++++++diypvfrel++k+
  VIMSS303965 392 LQSTFDNFAMQHIRDQDDIYPVFRELFHKQ 421
                  ***************************996 PP



Or compare VIMSS303965 to CDD or PaperBLAST