PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS339498 to PF04285 (DUF444)

VIMSS339498 has 423 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
     8e-192  623.9   2.8     9e-192  623.8   2.8    1.0  1  VIMSS339498  


Domain annotation for each sequence (and alignments):
>> VIMSS339498  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  623.8   2.8    9e-192    9e-192       1     421 []       3     421 ..       3     421 .. 0.99

  Alignments for each domain:
  == domain 1  score: 623.8 bits;  conditional E-value: 9e-192
       DUF444   1 iiidrrlngknkslenrqRflrrvkeqikeavadavsersikdiskgekikipikdikepefeygkggeregVlpGnkefkeGdkierpeeggggggs 98 
                  ++idrrlngknks++nrqRfl+r+keqike+vadav++rsi+++++ge+++ip kdi+ep f++gkgg re+V+pGn++f +Gdkierp++gg+g+gs
  VIMSS339498   3 QFIDRRLNGKNKSAVNRQRFLKRHKEQIKESVADAVNRRSITNTETGEDVSIPHKDINEPIFHQGKGGVRERVHPGNDQFITGDKIERPKGGGQGSGS 100
                  59********************************************************************************************9999 PP

       DUF444  99 geg..seaGegedefefelsreEfldllfedLeLPdLekkklekveekktkragytrkGspsnldvkrtlrealkRrialkrpkeeelreleeelael 194
                  geg  s++Geg+def+f++s++E+ld+lfedLeLP+Lek++ +k++e+kt+rag++++G+psn++v r+l+++l+Rr+a++++k++ l+ele+el+++
  VIMSS339498 101 GEGnaSPDGEGQDEFVFQISKDEYLDILFEDLELPNLEKNQIAKITEWKTHRAGFQTAGIPSNISVIRSLQQSLARRTAMTAGKKRLLKELEDELTRI 198
                  9988899******************************************************************************************* PP

       DUF444 195 eaeeeekeseeleeleeeieeleerikripfidelDlRYrrvekepkpesnaVmfclmDvSGSMdetkkdlakrfFilLylFLkrkYekvevvFirHt 292
                  ++ e  +++ e+++l++eieel+++i+++pfid++DlR++++ek+p p+s+aVmfclmDvSGSMd+++kd+akrf++lLylFL+r+Ye+v+vvFirH+
  VIMSS339498 199 KNIEP-AQQLEENRLKKEIEELRKKIENVPFIDTFDLRFKNYEKRPVPSSQAVMFCLMDVSGSMDQATKDIAKRFYVLLYLFLTRTYENVDVVFIRHH 295
                  99887.555599************************************************************************************** PP

       DUF444 293 teAkeVdeeeFFysresGGTvvSsalelmkeiieerYppseWNiYaaqasDgdnwseDsekavellaekilplvqyfaYveitpsaseeeqtlweeye 390
                  t+AkeVde+eFFys+e+GGT+vSsal+lm+ei++erYp+ +WNiYaaqasDgdnw++Ds+++++ll +k+lp +qy++Y+eit+   +++qtlw+eye
  VIMSS339498 296 TQAKEVDEHEFFYSQETGGTIVSSALKLMDEIVKERYPVGQWNIYAAQASDGDNWADDSPRCRDLLVNKLLPNCQYYSYIEITR---RSHQTLWHEYE 390
                  ************************************************************************************...*********** PP

       DUF444 391 kvaeeeenfamakvkekediypvfrellkke 421
                  k+++e++nfam+++++ edi+pvfrel++ke
  VIMSS339498 391 KLTDEFPNFAMKNIRSVEDIFPVFRELFQKE 421
                  *****************************97 PP



Or compare VIMSS339498 to CDD or PaperBLAST