PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS37431 to PF04285 (DUF444)

VIMSS37431 has 392 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
   1.9e-106  342.7  18.4      3e-71  226.7   4.7    2.0  2  VIMSS37431  


Domain annotation for each sequence (and alignments):
>> VIMSS37431  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  122.1   5.9   1.7e-39   1.7e-39       2     177 ..      11     186 ..      10     191 .. 0.92
   2 !  226.7   4.7     3e-71     3e-71     228     420 ..     195     382 ..     187     383 .. 0.97

  Alignments for each domain:
  == domain 1  score: 122.1 bits;  conditional E-value: 1.7e-39
      DUF444   2 iidrrlngknkslenrqRflrrvkeqikeavadavsersikdiskgekikipikdikepefeygkggeregVlpGnkefkeGdkierpeeggggggsge 100
                 i +++++ ++k  +++qR++++v+e+ik+++ d+v+e+si+  + ++ +kipi++++e++++y+  +++++V++G++e + Gd ++r+ +++ ++g g+
  VIMSS37431  11 ISEENWSLHRKGFDDQQRHQKKVQEAIKNNLPDLVTEESIIMSNGKDVVKIPIRSLDEYKIRYN-YDKNKHVGQGDGESQVGDVVARDGSDK-KQGPGK 107
                 567788899*********************************99999****************9.999*******************97765.456677 PP

      DUF444 101 gseaG..egedefefelsreEfldllfedLeLPdLekkklekveekktkragytrkGspsnldvkrtlrealkRrialk 177
                 g+ aG   ged +e e+s  ++ + lf +LeLP+L++k+ +++ +++ ++++++++G   n+d+krt+++a+kR    +
  VIMSS37431 108 GQGAGdqAGEDYYEAEVSLMDLEEALFKELELPNLQQKERDNIIHTDIEFNDIRKTGLTGNIDKKRTMMSAFKRNAMSG 186
                 77777435******************************************************************87655 PP

  == domain 2  score: 226.7 bits;  conditional E-value: 3e-71
      DUF444 228 elDlRYrrvekepkpesnaVmfclmDvSGSMdetkkdlakrfFilLylFLkrkYekvevvFirHtteAkeVdeeeFFysresGGTvvSsalelmkeiie 326
                 + Dl+Y++++  +kpes+aV++++mD+SGSM   +k++a++fF+++ +FL++kYe+ve+ Fi+H+teA+ V+ee+FF + esGGT++Ss +++  e+i+
  VIMSS37431 195 PEDLKYKTWNDITKPESKAVVLAMMDTSGSMGVWEKYMARSFFFWMTRFLRTKYETVEIEFIAHHTEARVVSEEDFFSKGESGGTICSSVYRKSLELID 293
                 45************************************************************************************************* PP

      DUF444 327 erYppseWNiYaaqasDgdnwseDsekavellaekilplvqyfaYveitpsaseeeqtlweeyekvaeeeenfamakvkekediypvfrellkk 420
                 e+Y+p+++NiY ++ sDgdn+++D++++v+ l ++i++++++f Y e+++  +++++tl+++y++v++  e+f+   +k+k+d+++++++++++
  VIMSS37431 294 EKYNPARYNIYPFHFSDGDNLTSDNARCVK-LVNDIMKKANLFCYGEVNQ--YNRHSTLMSAYKNVKD--EKFKYYILKQKSDVFQALKNFFRN 382
                 ******************************.9999***************..**************99..7*********************87 PP



Or compare VIMSS37431 to CDD or PaperBLAST