PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS383666 to PF04285 (DUF444)

VIMSS383666 has 447 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.4e-35  108.4   9.0    5.3e-29   87.5   0.7    2.1  2  VIMSS383666  


Domain annotation for each sequence (and alignments):
>> VIMSS383666  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.1   2.1   4.8e-10   4.8e-10      47     178 ..     100     232 ..      71     243 .. 0.74
   2 !   87.5   0.7   5.3e-29   5.3e-29     228     362 ..     248     384 ..     242     415 .. 0.88

  Alignments for each domain:
  == domain 1  score: 25.1 bits;  conditional E-value: 4.8e-10
       DUF444  47 gekikipikdikepefeyg..kggeregVlpGnkefkeGdkierpeeggggggsgegseaGegedefefelsreEfldllfedLeLPdLekkk.lekv 141
                  +eki +    ++e  ++    +++e++  + G+++ +eG+ i++++   +++g +    +Gege + e e +  ++ ++l e  +LP+L++k+ ++++
  VIMSS383666 100 KEKIVVVPTTVEEKLIHDRapEETEEDESMGGTGDGDEGEIIGEQPVRPQQEGGSGTAGHGEGEGH-ELESTAYDLGRILTERFDLPNLKEKGkKSSL 196
                  455555556677776666555666777778888888999999776665555553333566677655.5677888999***************945566 PP

       DUF444 142 eekktkragytrkGspsnldvkrtlrealkRrialkr 178
                  ++++++ ++ +++G  + l++k+tlr+ l+  ial+ 
  VIMSS383666 197 SHYSYDLTD-RNRGFGQILEKKQTLRRILETNIALGT 232
                  666666666.688****************99999976 PP

  == domain 2  score: 87.5 bits;  conditional E-value: 5.3e-29
       DUF444 228 elDlRYrrvekepkpesnaVmfclmDvSGSMdetkkdlakrfFilLylFLkrkY.ekvevvFirHtteAkeV.deeeFFysresGGTvvSsalelmke 323
                  + D  Yr   +e + es+a +f+++D SGSM+ +  + + + ++l+y +L  ++ ++ve  Fi H+++A+eV d  +++  r +GGT+v +a+++++e
  VIMSS383666 248 PRDRVYRILSRELEYESQALVFFIRDYSGSMEGKATEAVCSQHVLIYSWLLYQFaRQVETRFILHDNDAREVpDFYTYYNLRVAGGTRVAAAYRMVNE 345
                  568889999999************************************999998457***************56689999****************** PP

       DUF444 324 iieerYppseWNiYaaqasDgdnwseDsekavellaeki 362
                  i+e++  ++++NiY+++  Dgd w+   e+++  l++ +
  VIMSS383666 346 IVEKESLARDYNIYVFHGTDGDDWDTNGEETIPELRRML 384
                  *************************99999887665544 PP



Or compare VIMSS383666 to CDD or PaperBLAST