PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS57038 to PF04285 (DUF444)

VIMSS57038 has 423 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
   2.7e-184  599.1   0.3     3e-184  599.0   0.3    1.0  1  VIMSS57038  


Domain annotation for each sequence (and alignments):
>> VIMSS57038  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  599.0   0.3    3e-184    3e-184       2     420 ..       4     419 ..       3     420 .. 0.99

  Alignments for each domain:
  == domain 1  score: 599.0 bits;  conditional E-value: 3e-184
      DUF444   2 iidrrlngknkslenrqRflrrvkeqikeavadavsersikdiskgekikipikdikepefeygkggeregVlpGnkefkeGdkierpeeggggggsge 100
                 +idrrlngknks++nrqRflrr++e+ik+av++avs+rsi+d+++ge+i+ip +di+ep +++g+gg+++ V+pGnkef++G++i+rp++gggg+g g+
  VIMSS57038   4 VIDRRLNGKNKSTVNRQRFLRRYREHIKKAVEEAVSRRSITDMEHGEQISIPGRDIDEPVLHHGRGGRQTVVHPGNKEFTAGEHIARPSGGGGGRGGGK 102
                 79**********************************************************************************************999 PP

      DUF444 101 gseaGegedefefelsreEfldllfedLeLPdLekkklekveekktkragytrkGspsnldvkrtlrealkRrialkrpkeeelreleeelaeleaeee 199
                  s++Geg+d+f+f++++eEfld++fedLeLP+L+k++ + ++++kt rag++++G+ps+++++rtlr+a++Rrial+ +++++lr++ +el+++++ee 
  VIMSS57038 103 ASNSGEGMDDFVFQITQEEFLDFMFEDLELPNLVKRHITGTDTFKTVRAGISNDGNPSRINIVRTLRSAHARRIALSGGSRAKLRAALKELERIKREEP 201
                 9*********************************************************************************************99987 PP

      DUF444 200 ekeseeleeleeeieeleerikripfidelDlRYrrvekepkpesnaVmfclmDvSGSMdetkkdlakrfFilLylFLkrkYekvevvFirHtteAkeV 298
                  ++  +++ele ei++l++ri+r+pf+d++Dl+Y+  +k+p+p+s+aVmfclmDvSGSM++++kd+akrfFilLylFLkr+Yek+evvFirH+t+A+eV
  VIMSS57038 202 -DNLGDIQELELEIAKLRARIDRVPFLDTFDLKYNLLVKQPNPTSKAVMFCLMDVSGSMTQATKDIAKRFFILLYLFLKRNYEKIEVVFIRHHTSAREV 299
                 .55669********************************************************************************************* PP

      DUF444 299 deeeFFysresGGTvvSsalelmkeiieerYppseWNiYaaqasDgdnwseDsekavellaekilplvqyfaYveitpsaseeeqtlweeyekvaeee. 396
                 deeeFFysre+GGT+vSsal++m+ei++erYp++eWNiYaaqasDgdnw++Ds+ ++++l ++i+p vqy++Yveitp   +e+q+lw eye+v+e++ 
  VIMSS57038 300 DEEEFFYSRETGGTIVSSALKMMQEIMAERYPTHEWNIYAAQASDGDNWNDDSPVCRDILLKQIMPFVQYYTYVEITP---REHQALWFEYERVREAFe 395
                 ******************************************************************************...****************99 PP

      DUF444 397 enfamakvkekediypvfrellkk 420
                 ++fa +++ +++diypvfrel+++
  VIMSS57038 396 DSFAQQQIVSASDIYPVFRELFQR 419
                 **********************98 PP



Or compare VIMSS57038 to CDD or PaperBLAST