PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS7779322 to PF04285 (DUF444)

VIMSS7779322 has 423 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
   2.8e-183  595.8   0.2   3.2e-183  595.6   0.2    1.0  1  VIMSS7779322  


Domain annotation for each sequence (and alignments):
>> VIMSS7779322  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  595.6   0.2  3.2e-183  3.2e-183       2     420 ..       4     419 ..       3     420 .. 0.99

  Alignments for each domain:
  == domain 1  score: 595.6 bits;  conditional E-value: 3.2e-183
        DUF444   2 iidrrlngknkslenrqRflrrvkeqikeavadavsersikdiskgekikipikdikepefeygkggeregVlpGnkefkeGdkierpeeggggggs 98 
                   +idrrlngknks++nrqRflrr++++ik+av++avs+rsi+d+++ge+i+ip +di+ep +++g+gg+++ V+pGnkef++G++i+rp++gggg+g 
  VIMSS7779322   4 VIDRRLNGKNKSTVNRQRFLRRYRDHIKKAVEEAVSRRSITDMEHGEQISIPGRDIDEPVLHHGRGGKQTVVHPGNKEFTTGEHIQRPQGGGGGKGP 100
                   79*********************************************************************************************** PP

        DUF444  99 gegseaGegedefefelsreEfldllfedLeLPdLekkklekveekktkragytrkGspsnldvkrtlrealkRrialkrpkeeelreleeelaele 195
                   g+ +++Geg+def+f++++eEfl+++fedLeLP+L+k++l+ ++++kt rag++++G+ps++++ rtlr+a++Rrial+ +++++lr+++eela+l+
  VIMSS7779322 101 GKAGNSGEGMDEFVFQITQEEFLEFMFEDLELPNLVKRNLTGTDTFKTVRAGISNEGNPSRINIIRTLRSAHARRIALSGSSRAKLRDAKEELARLK 197
                   ************************************************************************************************* PP

        DUF444 196 aeeeekeseeleeleeeieeleerikripfidelDlRYrrvekepkpesnaVmfclmDvSGSMdetkkdlakrfFilLylFLkrkYekvevvFirHt 292
                   +ee  ++  +++e e+eie+l++ri+r+pf+d++Dl+Y+  +k+p+p+s+aVmfclmDvSGSM++++kd+akrfFilLylFLkr+Y+k++vvFirH+
  VIMSS7779322 198 REEP-DNFGDIQEIEAEIEKLSARIHRVPFLDTFDLKYNLLVKQPNPSSKAVMFCLMDVSGSMTQATKDIAKRFFILLYLFLKRNYDKIDVVFIRHH 293
                   *988.55559*************************************************************************************** PP

        DUF444 293 teAkeVdeeeFFysresGGTvvSsalelmkeiieerYppseWNiYaaqasDgdnwseDsekavellaekilplvqyfaYveitpsaseeeqtlweey 389
                   t+A+eVdeeeFFysre+GGT+vSsal+lm+ei++erYp++eWNiYaaqasDgdnw++Ds+ ++++l ++i+p vqy++Yveitp   +e+q+lw ey
  VIMSS7779322 294 TSAREVDEEEFFYSRETGGTIVSSALKLMQEIMAERYPANEWNIYAAQASDGDNWNDDSPICRDILINQIMPFVQYYTYVEITP---REHQALWFEY 387
                   ************************************************************************************...********** PP

        DUF444 390 ekvaeee.enfamakvkekediypvfrellkk 420
                   e++ e++ ++fa +++ ++ diypvfrel+++
  VIMSS7779322 388 ERIGEAFaDTFAQQQLVSAGDIYPVFRELFQR 419
                   *****999**********************98 PP



Or compare VIMSS7779322 to CDD or PaperBLAST