PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS876290 to PF04285 (DUF444)

VIMSS876290 has 424 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   2.8e-183  595.8   0.2   3.2e-183  595.6   0.2    1.0  1  VIMSS876290  


Domain annotation for each sequence (and alignments):
>> VIMSS876290  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  595.6   0.2  3.2e-183  3.2e-183       2     420 ..       4     420 ..       3     421 .. 0.98

  Alignments for each domain:
  == domain 1  score: 595.6 bits;  conditional E-value: 3.2e-183
       DUF444   2 iidrrlngknkslenrqRflrrvkeqikeavadavsersikdiskgekikipikdikepefeygkggeregVlpGnkefkeGdkierpeegggggg.s 98 
                  +idrrlngknks++nrqRflrr++++ik+av++avs+rsi+d+++ge+i+ip +di+ep +++g+gg+++ V+pGnkef++G++i+rp++gggggg +
  VIMSS876290   4 VIDRRLNGKNKSTVNRQRFLRRYRDHIKKAVEEAVSRRSITDMEHGEQISIPGRDIDEPVLHHGRGGKQTVVHPGNKEFTAGEHIARPQGGGGGGGgR 101
                  79***************************************************************************************998877624 PP

       DUF444  99 gegseaGegedefefelsreEfldllfedLeLPdLekkklekveekktkragytrkGspsnldvkrtlrealkRrialkrpkeeelreleeelaelea 196
                  g+ +++Geg+def+f++++eEfl+++fedLeLP+L+k++l+ ++++kt rag++++G+p+++++ rtlr+a++Rrial+ +++++lre++eela+l++
  VIMSS876290 102 GKAGNSGEGMDEFVFQITQEEFLEFMFEDLELPNLVKRNLTGTDTFKTVRAGISNEGNPARINIIRTLRSAHARRIALSGSSRAKLREAKEELARLKR 199
                  5559********************************************************************************************** PP

       DUF444 197 eeeekeseeleeleeeieeleerikripfidelDlRYrrvekepkpesnaVmfclmDvSGSMdetkkdlakrfFilLylFLkrkYekvevvFirHtte 294
                  ee  ++  +++ele+eie+l++ri+r+pf+d++Dl+Y+  +k+p+p+s+aVmfclmDvSGSM++++kd+akrfFilLylFLkr+Y+k++vvFirH+t+
  VIMSS876290 200 EEP-DNFGDIQELEAEIERLSARIHRVPFLDTFDLKYNLLVKQPNPSSKAVMFCLMDVSGSMTQATKDIAKRFFILLYLFLKRNYDKIDVVFIRHHTS 296
                  988.55559***************************************************************************************** PP

       DUF444 295 AkeVdeeeFFysresGGTvvSsalelmkeiieerYppseWNiYaaqasDgdnwseDsekavellaekilplvqyfaYveitpsaseeeqtlweeyekv 392
                  A+eVdeeeFFysre+GGT+vSsal+lm+ei++erYp++eWNiYaaqasDgdnw++Ds+ ++++l ++i+p vqy++Yveitp   +e+q+lw eye++
  VIMSS876290 297 AREVDEEEFFYSRETGGTIVSSALKLMQEIMAERYPSNEWNIYAAQASDGDNWNDDSPICRDILINQIMPFVQYYTYVEITP---REHQALWFEYERI 391
                  **********************************************************************************...************* PP

       DUF444 393 aeee.enfamakvkekediypvfrellkk 420
                  ae++ ++fa +++ ++ diypvfrel+++
  VIMSS876290 392 AEAFsDTFAQQQLVSAGDIYPVFRELFQR 420
                  ***99**********************98 PP



Or compare VIMSS876290 to CDD or PaperBLAST