PaperBLAST – Find papers about a protein or its homologs

 

Align WP_002010376.1 to PF04285 (DUF444)

WP_002010376.1 has 391 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   9.9e-108  346.9  17.3    1.2e-72  231.4   5.0    2.0  2  WP_002010376.1  


Domain annotation for each sequence (and alignments):
>> WP_002010376.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  121.8   4.9   2.1e-39   2.1e-39       2     175 ..      11     186 ..      10     193 .. 0.91
   2 !  231.4   5.0   1.2e-72   1.2e-72     222     421 .]     192     385 ..     184     385 .. 0.96

  Alignments for each domain:
  == domain 1  score: 121.8 bits;  conditional E-value: 2.1e-39
          DUF444   2 iidrrlngknkslenrqRflrrvkeqikeavadavsersikdiskgekikipikdikepefeygkggeregVlpGnkefkeGdkierpeeggg.g 95 
                     i +++++ ++k  +++qR++++v+e+ik+++ d+v+e+si   + ++ +kipi++++e++++y+  +++++V++Gn++ k Gd ++r+ +gg+ +
  WP_002010376.1  11 ISQENWSLHRKGYDDQQRHQEKVQEAIKNNLPDLVTEESIVMSNGKDVVKIPIRSLDEYKIRYN-YDKNKHVGQGNGDSKVGDVVARDGSGGQkQ 104
                     566778889*********************************999999***************9.999*****************9997765415 PP

          DUF444  96 ggsgegseaG..egedefefelsreEfldllfedLeLPdLekkklekveekktkragytrkGspsnldvkrtlrealkRria 175
                     +g g+g+ aG   ged +e e+s  E+ + +f +LeLP+L++k++++ + ++ ++++++++G   n+d+krt+ +a+kR   
  WP_002010376.1 105 KGPGKGQGAGdaAGEDYYEAEVSILELEQAFFKELELPNLKRKEMDENRIEHIEFNDIRKTGLWGNIDKKRTMISAYKRNAM 186
                     5666667777435*****************************************************************9754 PP

  == domain 2  score: 231.4 bits;  conditional E-value: 1.2e-72
          DUF444 222 ripfidelDlRYrrvekepkpesnaVmfclmDvSGSMdetkkdlakrfFilLylFLkrkYekvevvFirHtteAkeVdeeeFFysresGGTvvSs 316
                       p  +e Dl++r+++++ kp+s+aV++++mD+SGSM   +k++a++fF+++ +FL++kYe+v++ Fi+H+teAk V+eeeFF + esGGT++Ss
  WP_002010376.1 192 FHPIHQE-DLKFRTWNEVLKPDSKAVVLAMMDTSGSMGIWEKYMARSFFFWMTRFLRTKYETVDIEFIAHHTEAKVVTEEEFFSKGESGGTICSS 285
                     4566666.*************************************************************************************** PP

          DUF444 317 alelmkeiieerYppseWNiYaaqasDgdnwseDsekavellaekilplvqyfaYveitpsaseeeqtlweeyekvaeeeenfamakvkekediy 411
                      ++++ e+i+++Y+p+++NiY ++ sDgdn+++D++++v+ l e++++++++f+Y e+++  +++++tl+++y+++++  enf    +k+k+d++
  WP_002010376.1 286 VYKKALELIDNKYSPDRYNIYPFHFSDGDNLTSDNARCVK-LVEELMKKCNMFGYGEVNQ--YNRHSTLMSAYKNIKD--ENFRYYILKQKADVF 375
                     ****************************************.8999***************..**************99..7************** PP

          DUF444 412 pvfrellkke 421
                     +++++++k+e
  WP_002010376.1 376 HAMKSFFKEE 385
                     *******975 PP



Or compare WP_002010376.1 to CDD or PaperBLAST