PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::MR1:202009 to PF04285 (DUF444)

reanno::MR1:202009 has 422 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------           -----------
   7.2e-189  614.2   3.3   8.1e-189  614.0   3.3    1.0  1  reanno::MR1:202009  


Domain annotation for each sequence (and alignments):
>> reanno::MR1:202009  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  614.0   3.3  8.1e-189  8.1e-189       2     421 .]       4     420 ..       3     420 .. 0.98

  Alignments for each domain:
  == domain 1  score: 614.0 bits;  conditional E-value: 8.1e-189
              DUF444   2 iidrrlngknkslenrqRflrrvkeqikeavadavsersikdiskgekikipikdikepefeygkggeregVlpGnkefkeGdkierpeeg 92 
                         +idrrln+k+ks++nrqRf++r+k+qik+av+dav++rs++d++kgeki+ip++di+ep f++gkgg r++V+pGn++f++Gdki+rp++g
  reanno::MR1:202009   4 FIDRRLNAKGKSTVNRQRFINRYKQQIKKAVSDAVTRRSVTDVDKGEKISIPTRDISEPMFHQGKGGVRDRVHPGNDQFTRGDKIDRPQGG 94 
                         9****************************************************************************************99 PP

              DUF444  93 gggg.gsgegseaGegedefefelsreEfldllfedLeLPdLekkklekveekktkragytrkGspsnldvkrtlrealkRrialkrpkee 182
                         +ggg g+g+ s++Geg+d+f+fe+s++E+l+llfedLeLP+L+k++l+k+ e++  rag+t++G+p+n++++r+lr++l+Rria++++k++
  reanno::MR1:202009  95 SGGGaGKGDASDSGEGNDDFVFEISKDEYLELLFEDLELPNLQKNRLNKLVEYQIYRAGFTNDGVPANINIVRSLRSSLARRIAMSASKKK 185
                         8765146666********************************************************************************* PP

              DUF444 183 elreleeelaeleaeeeekeseeleeleeeieeleerikripfidelDlRYrrvekepkpesnaVmfclmDvSGSMdetkkdlakrfFilL 273
                          l+e e+elaele+    +++e + +l+++ieel+++i+++pfid++DlR++++ +++ p+s+aVmfclmDvSGSMd+++kd+akrf+ilL
  reanno::MR1:202009 186 LLKESEQELAELENIPG-TKAELILDLKAQIEELKRKIAKVPFIDTFDLRFNNFSRREVPSSQAVMFCLMDVSGSMDQATKDMAKRFYILL 275
                         ************99977.55669******************************************************************** PP

              DUF444 274 ylFLkrkYekvevvFirHtteAkeVdeeeFFysresGGTvvSsalelmkeiieerYppseWNiYaaqasDgdnwseDsekavellaekilp 364
                         ylFL+r+Y++ evv+irH+t+AkeVde+eFFys+e+GGT+vSsal+lm+ei ++rYp++eWNiYaaqasDgdnw++Ds+++++ll++kilp
  reanno::MR1:202009 276 YLFLTRTYKNLEVVYIRHHTQAKEVDEHEFFYSQETGGTIVSSALKLMHEIQQARYPADEWNIYAAQASDGDNWADDSPTCKQLLEQKILP 366
                         ******************************************************************************************* PP

              DUF444 365 lvqyfaYveitpsaseeeqtlweeyekvaeeeenfamakvkekediypvfrellkke 421
                         lv+yf+Y+eit+   +++qtlw+eye+++++ +n+a+++++++ediypvfrel+kk+
  reanno::MR1:202009 367 LVRYFSYIEITN---RAHQTLWREYESLQQHYDNIAVQHIRQAEDIYPVFRELFKKQ 420
                         ************...***************99***********************96 PP



Or compare reanno::MR1:202009 to CDD or PaperBLAST