PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::SB2B:6937781 to PF04285 (DUF444)

reanno::SB2B:6937781 has 423 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence             Description
    ------- ------ -----    ------- ------ -----   ---- --  --------             -----------
     2e-189  616.1   3.4   2.2e-189  615.9   3.4    1.0  1  reanno::SB2B:6937781  


Domain annotation for each sequence (and alignments):
>> reanno::SB2B:6937781  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  615.9   3.4  2.2e-189  2.2e-189       2     421 .]       4     421 ..       3     421 .. 0.99

  Alignments for each domain:
  == domain 1  score: 615.9 bits;  conditional E-value: 2.2e-189
                DUF444   2 iidrrlngknkslenrqRflrrvkeqikeavadavsersikdiskgekikipikdikepefeygkggeregVlpGnkefkeGdkierpe 90 
                           +idrrln+k+ks++nrqRf++r+k+qik+av+dav++rs++d++kge+i+ip++di+ep f++g+gg re+V+pGn++f++Gd+i+rp+
  reanno::SB2B:6937781   4 FIDRRLNAKGKSTVNRQRFINRYKKQIKKAVSDAVTRRSVTDVDKGEQISIPTRDITEPMFHQGRGGFRERVHPGNDQFTRGDRIDRPP 92 
                           9**************************************************************************************** PP

                DUF444  91 eggggggsgeg..seaGegedefefelsreEfldllfedLeLPdLekkklekveekktkragytrkGspsnldvkrtlrealkRrialk 177
                           +gggg+gsg+g  s++G+g+d+f+f++s++E+l+llfedLeLP+L++++l+k+ e++++ragyt++G+p+n++++r+lr++l+Rr+a++
  reanno::SB2B:6937781  93 QGGGGQGSGQGdaSDSGDGQDDFVFQISKDEYLELLFEDLELPNLQRNRLNKLVEYQVQRAGYTNDGVPANISIVRSLRSSLARRTAMT 181
                           *****999998889*************************************************************************** PP

                DUF444 178 rpkeeelreleeelaeleaeeeekeseeleeleeeieeleerikripfidelDlRYrrvekepkpesnaVmfclmDvSGSMdetkkdla 266
                           ++k+++l++le+el+ele++  ++++ ++ +l++eie+l+++i+++pfid++DlRY++++k++ p+s+aVmfclmDvSGSMd+++kd+a
  reanno::SB2B:6937781 182 AAKKRHLKTLEAELEELENTPGANAD-RILALKTEIEALRKKIDAVPFIDTFDLRYNNFTKREVPSSQAVMFCLMDVSGSMDQATKDMA 269
                           *******************9885555.9************************************************************* PP

                DUF444 267 krfFilLylFLkrkYekvevvFirHtteAkeVdeeeFFysresGGTvvSsalelmkeiieerYppseWNiYaaqasDgdnwseDsekav 355
                           krf+ilLylFL+r+Y++ evv+irH+t+AkeVde+eFFys+e+GGT+vSsal+lm ei +erYp++eWNiYaaqasDgdnw++Ds++++
  reanno::SB2B:6937781 270 KRFYILLYLFLTRTYKNLEVVYIRHHTQAKEVDEHEFFYSQETGGTIVSSALKLMVEIQKERYPAEEWNIYAAQASDGDNWADDSPTCR 358
                           ***************************************************************************************** PP

                DUF444 356 ellaekilplvqyfaYveitpsaseeeqtlweeyekvaeeeenfamakvkekediypvfrellkke 421
                           ++l+++ilp+v+yf+Y+eit+   +++qtlw+ey+++++  +n+a+++++++ediypvfrel+kk+
  reanno::SB2B:6937781 359 QILEKQILPTVRYFSYIEITN---RAHQTLWREYDSLRQVYDNMAVQHIRQAEDIYPVFRELFKKQ 421
                           *********************...***************99***********************96 PP



Or compare reanno::SB2B:6937781 to CDD or PaperBLAST