PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::pseudo3_N2E3:AO353_07340 to PF04285 (DUF444)

reanno::pseudo3_N2E3:AO353_07340 has 423 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
     2e-182  593.0   0.1   2.2e-182  592.8   0.1    1.0  1  reanno::pseudo3_N2E3:AO353_07340  


Domain annotation for each sequence (and alignments):
>> reanno::pseudo3_N2E3:AO353_07340  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  592.8   0.1  2.2e-182  2.2e-182       2     420 ..       4     419 ..       3     420 .. 0.99

  Alignments for each domain:
  == domain 1  score: 592.8 bits;  conditional E-value: 2.2e-182
                            DUF444   2 iidrrlngknkslenrqRflrrvkeqikeavadavsersikdiskgekikipikdikepefeygkggeregVlpGnk 78 
                                       +idrrlngknks++nrqRflrr++++ik+av++avs+rsi+d+++ge+i+ip +di+ep +++g+gg+++ V+pGnk
  reanno::pseudo3_N2E3:AO353_07340   4 VIDRRLNGKNKSTVNRQRFLRRYRDHIKKAVEEAVSRRSITDMEHGEQISIPGRDIDEPVLHHGRGGKQTIVHPGNK 80 
                                       79*************************************************************************** PP

                            DUF444  79 efkeGdkierpeeggggggsgegseaGegedefefelsreEfldllfedLeLPdLekkklekveekktkragytrkG 155
                                       ef++G++i+rp++gggg+g g+ +++Geg+def+f++++eEfl+++fedLeLP+L+k++l+ ++++kt rag++++G
  reanno::pseudo3_N2E3:AO353_07340  81 EFTSGEHIARPPGGGGGRGPGKAGNSGEGMDEFVFQITQEEFLEFMFEDLELPNLVKRNLSGTDTFKTVRAGISNEG 157
                                       *********************99****************************************************** PP

                            DUF444 156 spsnldvkrtlrealkRrialkrpkeeelreleeelaeleaeeeekeseeleeleeeieeleerikripfidelDlR 232
                                       +ps++++ rtlr+a++Rrial+ +++e+lr ++eela+l++ee  ++  +++e e+eie+l++ri+r+pf+d++Dl+
  reanno::pseudo3_N2E3:AO353_07340 158 NPSRINIIRTLRSAHARRIALSGSSREKLRVAKEELARLKQEEP-DNFGDIQEIEAEIERLSARINRVPFLDTFDLK 233
                                       ***************************************99987.55559*************************** PP

                            DUF444 233 YrrvekepkpesnaVmfclmDvSGSMdetkkdlakrfFilLylFLkrkYekvevvFirHtteAkeVdeeeFFysres 309
                                       Y+   k+p+p+s+aVmfclmDvSGSM++++kd+akrfFilLylFLkr+Yek++vvFirH+t+A+eVdeeeFFysre+
  reanno::pseudo3_N2E3:AO353_07340 234 YNLLIKQPNPSSKAVMFCLMDVSGSMTQATKDIAKRFFILLYLFLKRNYEKIDVVFIRHHTSAREVDEEEFFYSRET 310
                                       ***************************************************************************** PP

                            DUF444 310 GGTvvSsalelmkeiieerYppseWNiYaaqasDgdnwseDsekavellaekilplvqyfaYveitpsaseeeqtlw 386
                                       GGT+vSsal+lm+ei++erYp+++WNiYaaqasDgdnw++Ds+ ++++l ++i+p vqy++Yveitp   +e+q+lw
  reanno::pseudo3_N2E3:AO353_07340 311 GGTIVSSALKLMQEIMAERYPSNDWNIYAAQASDGDNWNDDSPICRDILINQIMPFVQYYTYVEITP---REHQALW 384
                                       *******************************************************************...******* PP

                            DUF444 387 eeyekvaeee.enfamakvkekediypvfrellkk 420
                                       +eye+++e++ ++fa +++ ++ diypvfrel+++
  reanno::pseudo3_N2E3:AO353_07340 385 YEYERISEAFsDTFAQQQLVSAGDIYPVFRELFQR 419
                                       *********99**********************98 PP



Or compare reanno::pseudo3_N2E3:AO353_07340 to CDD or PaperBLAST