PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::pseudo5_N2C3_1:AO356_14310 to PF04285 (DUF444)

reanno::pseudo5_N2C3_1:AO356_14310 has 423 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
     6e-184  598.0   0.2   6.8e-184  597.8   0.2    1.0  1  reanno::pseudo5_N2C3_1:AO356_14310  


Domain annotation for each sequence (and alignments):
>> reanno::pseudo5_N2C3_1:AO356_14310  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  597.8   0.2  6.8e-184  6.8e-184       2     420 ..       4     419 ..       3     420 .. 0.99

  Alignments for each domain:
  == domain 1  score: 597.8 bits;  conditional E-value: 6.8e-184
                              DUF444   2 iidrrlngknkslenrqRflrrvkeqikeavadavsersikdiskgekikipikdikepefeygkggeregVlpG 76 
                                         +idrrlngknks++nrqRflrr++++ik+av++avs+rsi+d+++ge+i+ip +di+ep +++g+gg+++ V+pG
  reanno::pseudo5_N2C3_1:AO356_14310   4 VIDRRLNGKNKSTVNRQRFLRRYRDHIKKAVEEAVSRRSITDMEHGEQISIPGRDIDEPVLHHGRGGKQTVVHPG 78 
                                         79************************************************************************* PP

                              DUF444  77 nkefkeGdkierpeeggggggsgegseaGegedefefelsreEfldllfedLeLPdLekkklekveekktkragy 151
                                         nkef++G++i rp++gg+g+g g+ +++Geg+def+f++++eEfl+++fedLeLP+L+k++l+ ++++kt rag+
  reanno::pseudo5_N2C3_1:AO356_14310  79 NKEFTSGEHIPRPQGGGAGKGPGKAGNSGEGMDEFVFQITQEEFLEFMFEDLELPNLVKRNLTGTDTFKTVRAGI 153
                                         ***********************99************************************************** PP

                              DUF444 152 trkGspsnldvkrtlrealkRrialkrpkeeelreleeelaeleaeeeekeseeleeleeeieeleerikripfi 226
                                         +++G+ps++++ rtlr+a++Rrial+ +++++lre++eela+l++ee  ++  ++++le+eie+l++ri+r+pf+
  reanno::pseudo5_N2C3_1:AO356_14310 154 SNEGNPSRINIIRTLRSAHARRIALSGSSRAKLREAKEELARLKREEP-DNFGDIQDLEAEIEKLSARIHRVPFL 227
                                         *********************************************988.55559********************* PP

                              DUF444 227 delDlRYrrvekepkpesnaVmfclmDvSGSMdetkkdlakrfFilLylFLkrkYekvevvFirHtteAkeVdee 301
                                         d++Dl+Y+  +k+p+p+s+aVmfclmDvSGSM++++kd+akrfFilLylFLkr+Y+k++vvFirH+t+A+eVdee
  reanno::pseudo5_N2C3_1:AO356_14310 228 DTFDLKYNLLVKQPNPSSKAVMFCLMDVSGSMTQATKDIAKRFFILLYLFLKRNYDKIDVVFIRHHTSAREVDEE 302
                                         *************************************************************************** PP

                              DUF444 302 eFFysresGGTvvSsalelmkeiieerYppseWNiYaaqasDgdnwseDsekavellaekilplvqyfaYveitp 376
                                         eFFysre+GGT+vSsal+lm+ei++erYp++eWNiYaaqasDgdnw++Ds+ ++++l ++i+p vqy++Yveitp
  reanno::pseudo5_N2C3_1:AO356_14310 303 EFFYSRETGGTIVSSALKLMQEIMAERYPANEWNIYAAQASDGDNWNDDSPICRDILINQIMPFVQYYTYVEITP 377
                                         *************************************************************************** PP

                              DUF444 377 saseeeqtlweeyekvaeee.enfamakvkekediypvfrellkk 420
                                            +e+q+lw+eye++ae++ ++fa +++ ++ diypvfrel+++
  reanno::pseudo5_N2C3_1:AO356_14310 378 ---REHQALWYEYERIAEAFsDTFAQQQLVSAGDIYPVFRELFQR 419
                                         ...****************99**********************98 PP



Or compare reanno::pseudo5_N2C3_1:AO356_14310 to CDD or PaperBLAST