PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::pseudo6_N2E2:Pf6N2E2_4800 to PF04285 (DUF444)

reanno::pseudo6_N2E2:Pf6N2E2_4800 has 423 amino acids

Query:       DUF444  [M=421]
Accession:   PF04285.12
Description: Protein of unknown function (DUF444)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                          -----------
   2.2e-184  599.4   0.1   2.5e-184  599.2   0.1    1.0  1  reanno::pseudo6_N2E2:Pf6N2E2_4800  


Domain annotation for each sequence (and alignments):
>> reanno::pseudo6_N2E2:Pf6N2E2_4800  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  599.2   0.1  2.5e-184  2.5e-184       2     420 ..       4     419 ..       3     420 .. 0.99

  Alignments for each domain:
  == domain 1  score: 599.2 bits;  conditional E-value: 2.5e-184
                             DUF444   2 iidrrlngknkslenrqRflrrvkeqikeavadavsersikdiskgekikipikdikepefeygkggeregVlpGn 77 
                                        +idrrlngknks++nrqRflrr++++ik+av++avs+rsi+d+++ge+i+ip +di+ep +++g+gg+++ V+pGn
  reanno::pseudo6_N2E2:Pf6N2E2_4800   4 VIDRRLNGKNKSTVNRQRFLRRYRDHIKKAVEEAVSRRSITDMEHGEQISIPGRDIDEPVLHHGRGGKQTVVHPGN 79 
                                        79************************************************************************** PP

                             DUF444  78 kefkeGdkierpeeggggggsgegseaGegedefefelsreEfldllfedLeLPdLekkklekveekktkragytr 153
                                        kef++G++i rp++gggg+g g+ +++Geg+def+f++++eEfl+++fedLeLP+L+k++l+ ++++kt rag+++
  reanno::pseudo6_N2E2:Pf6N2E2_4800  80 KEFTSGEHIPRPQGGGGGKGPGKAGNSGEGMDEFVFQITQEEFLEFMFEDLELPNLVKRNLTGTDTFKTVRAGISN 155
                                        **************************************************************************** PP

                             DUF444 154 kGspsnldvkrtlrealkRrialkrpkeeelreleeelaeleaeeeekeseeleeleeeieeleerikripfidel 229
                                        +G+ps++++ rtlr+a++Rrial+ +++++lre++eela+l++ee  ++  ++++le+eie+l++ri+r+pf+d++
  reanno::pseudo6_N2E2:Pf6N2E2_4800 156 EGNPSRINIIRTLRSAHARRIALSGSSRAKLREVKEELARLKREEP-DNFGDIQDLEAEIEKLSARIHRVPFLDTF 230
                                        *******************************************988.55559************************ PP

                             DUF444 230 DlRYrrvekepkpesnaVmfclmDvSGSMdetkkdlakrfFilLylFLkrkYekvevvFirHtteAkeVdeeeFFy 305
                                        Dl+Y+  +k+p+p+s+aVmfclmDvSGSM++++kd+akrfFilLylFLkr+Y+k++vvFirH+t+A+eVdeeeFFy
  reanno::pseudo6_N2E2:Pf6N2E2_4800 231 DLKYNLLVKQPNPSSKAVMFCLMDVSGSMTQATKDIAKRFFILLYLFLKRNYDKIDVVFIRHHTSAREVDEEEFFY 306
                                        **************************************************************************** PP

                             DUF444 306 sresGGTvvSsalelmkeiieerYppseWNiYaaqasDgdnwseDsekavellaekilplvqyfaYveitpsasee 381
                                        sre+GGT+vSsal+lm+ei++erYp++eWNiYaaqasDgdnw++Ds+ ++++l ++i+p vqy++Yveitp   +e
  reanno::pseudo6_N2E2:Pf6N2E2_4800 307 SRETGGTIVSSALKLMQEIMAERYPANEWNIYAAQASDGDNWNDDSPICRDILINQIMPFVQYYTYVEITP---RE 379
                                        ***********************************************************************...** PP

                             DUF444 382 eqtlweeyekvaeee.enfamakvkekediypvfrellkk 420
                                        +q+lw+eye++ae++ ++fa +++ ++ diypvfrel+++
  reanno::pseudo6_N2E2:Pf6N2E2_4800 380 HQALWYEYERIAEAFsDTFAQQQLVSAGDIYPVFRELFQR 419
                                        **************99**********************98 PP



Or compare reanno::pseudo6_N2E2:Pf6N2E2_4800 to CDD or PaperBLAST