PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::A1C3L3 to PF04286 (DUF445)

SwissProt::A1C3L3 has 2587 amino acids

Query:       DUF445  [M=367]
Accession:   PF04286.12
Description: Protein of unknown function (DUF445)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    9.6e-65  205.8 279.0    2.6e-13   36.5  22.2   10.3  7  SwissProt::A1C3L3  


Domain annotation for each sequence (and alignments):
>> SwissProt::A1C3L3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    4.8   4.4    0.0011    0.0011     210     319 ..     111     220 ..      56     290 .. 0.51
   2 !   22.0  18.7     7e-09     7e-09     141     338 ..     516     710 ..     502     716 .. 0.74
   3 !   29.8  28.9   2.8e-11   2.8e-11      82     336 ..     703     960 ..     698     964 .. 0.40
   4 ?  -56.3 124.6         1         1     102     102 ..    1383    1383 ..     928    1891 .. 0.64
   5 !   24.4  40.8   1.2e-09   1.2e-09      77     296 ..    1867    2091 ..    1799    2148 .. 0.28
   6 !   26.5  36.5   2.9e-10   2.9e-10      77     305 ..    2091    2332 ..    2044    2368 .. 0.30
   7 !   36.5  22.2   2.6e-13   2.6e-13      79     357 ..    2304    2577 ..    2289    2578 .. 0.33

  Alignments for each domain:
  == domain 1  score: 4.8 bits;  conditional E-value: 0.0011
             DUF445 210 edkkvreliadllndpelaakveklkkkklsdlevq.eyeea.lwealkdlllkdlneeesllrerisklleklgeklaedpklreklnkfl 299
                        +d + +e+  +l +++++ ++v ++  + +s+  ++ e++++ ++e++++ ++++++e +   +++ +++ e+ ++++  ++  +++ nk  
  SwissProt::A1C3L3 111 FDSEKAEEKISLSQSESASESVSESISESVSESVSTsESVSEsVSESVSESISESVSE-S-ISESISESVSESTSTSIVLSESGAASGNKAT 200
                        2222222222222222233333222222222221110111112333333333333333.1.2222222222222222222222222222333 PP

             DUF445 300 enaaakvlekyrldiskive 319
                        ++ +++  ++ r++++k+++
  SwissProt::A1C3L3 201 SKGTEEKQDSVRENLDKMIS 220
                        33333333333333333333 PP

  == domain 2  score: 22.0 bits;  conditional E-value: 7e-09
             DUF445 141 kllddlldriknllkdeevkekikelidelieeesgklvlesivsmflrelt.silekvksdpdhllreeedkkvreliadllndpelaakv 231
                        ++  d   + + + k+e +++ i+e + e i+e +   v+es+++++ ++++ si+e v + + ++++e+ ++ v+e i++  + +++ +++
  SwissProt::A1C3L3 516 SIPSDTTSQSESTSKSESTSKSISESVIESISESVIGSVSESVSESVSESVSeSITESVSESVSESISESVSESVSESISESVS-ESVSESI 606
                        555566677788889999*********9*9999999999999999999887525788889999999999999999999999999.7899999 PP

             DUF445 232 eklkkkklsdlevqeyeealwealkdlllkdlneeesllrerisklleklgeklaed..pklreklnkflenaaakvlekyrldiskiveet 321
                         ++  + +s+ +++   e+++e++++ ++++++e  s  +++ +++ e+++e+++e+  + + e++ + +++ +++ + +   ++s+ v+e 
  SwissProt::A1C3L3 607 SESVSESVSESISESVSESVSESISESISESVSE--SVSESISESVSESVSESISESvsESVSESISESVSESVSESISE---SVSESVSES 693
                        9999999999999999999999999999999998..47777777777778888888877667777777666666554444...444444444 PP

             DUF445 322 vnafdaeeleelIeliv 338
                        + +   e ++e I + v
  SwissProt::A1C3L3 694 ISESVSESVSESISESV 710
                        44444444444444444 PP

  == domain 3  score: 29.8 bits;  conditional E-value: 2.8e-11
             DUF445  82 keslaaiveellkeiledlddesikellkknlkkkleevipepllgkllellleeerhkkllddlldriknllkdeevkekikelideliee 173
                        +es+++ v+e ++e +++  +es++e +++ +++ ++e i e + +++ ++ ++e   +++++++++ +++ ++++ v+e ++e ++e i+e
  SwissProt::A1C3L3 703 SESISESVSESVSESISESVSESVSESISESVSESVSESISESVSESV-SESISESVSESVSESISESVSESVSES-VSESVSESVSESISE 792
                        444444555555555555555555555555555555555555555555.444444444444455444444444332.222444444444444 PP

             DUF445 174 esgklvlesivsmflrelts.ilekvksdpdhllreeedkkvreliadllndpelaakveklkkkklsdlevqeyeealwealkdlllkdln 264
                         + + v+es+++++ +++++ + e + + + ++++e++++ v+e +++ ++ +++ ++v ++  + +s+  ++   e+++e++++ ++++++
  SwissProt::A1C3L3 793 SVSESVSESVSESVSESVSEsVSESISESVSESVSESISESVSESVSESIS-ESVSESVSESISESVSESVSESISESVSESVSESISESVS 883
                        444444333333333333220222333333444444444444444444444.3344444444444444444444444444444444444444 PP

             DUF445 265 eee..sllrerisklleklgeklaed..pklreklnkflenaa.akvlekyrldiskiveetvnafdaeeleelIel 336
                        e+   s  ++  +++ e+++e+++e+  + + e++ + +++ + ++v e+ ++++s+ v+e v +   e ++e I +
  SwissProt::A1C3L3 884 ESVseSISESVSESVSESISESVSESvsESISESVSESVSESIsESVSESVSESVSESVSESVSESVSESVSESISE 960
                        41121233333333333333444444444444444444433320233334444555555555555555555555555 PP

  == domain 4  score: -56.3 bits;  conditional E-value: 1
             DUF445  102 d 102 
                         +
  SwissProt::A1C3L3 1383 S 1383
                         0 PP

  == domain 5  score: 24.4 bits;  conditional E-value: 1.2e-09
             DUF445   77 k.......nptnkeslaaiveellkeiledlddesikellkknlkkkleevipepllgkllellleeerhkkllddlldriknllkdeev 159 
                         +        ++++es+++  +e ++e +++ ++es++e +++ +++ ++e   e + +++ ++ ++e   +++++++++ +++ ++ e v
  SwissProt::A1C3L3 1867 SesvsesiSESVSESVSESISESVSESVSESISESVSESVSESISESVSESVSESISESV-SESVSESISESVSESVSESVSESVS-ESV 1954
                         011111111111111111111111111111111111111111111111111111111111.1111111111111221122221111.111 PP

             DUF445  160 kekikelidelieeesgklvlesivsmflrelts.ilekvksdpdhllreeedkkvreliadllndpelaakveklkkkklsdlevqeye 248 
                         +e i+e ++e i+e + + v+esi++++ +++++ i e v + + ++++e+ ++ v+e i++  + +++ +++ ++  + +s+ +++   
  SwissProt::A1C3L3 1955 SESISESVSESISESVSESVSESISESVSESVSEsISESVSESVSESISESVSESVSESISESVS-ESVSESISESVSESVSESISESVS 2043
                         11222222222222222222222222222222110111122222222222222222222222222.122222222222222222222222 PP

             DUF445  249 ealwealkdlllkdlneeesllrerisklleklgeklaed..pklrekln 296 
                         e+++e++++ ++++++e  s  +++ +++ e+++e+++e+  + + e++ 
  SwissProt::A1C3L3 2044 ESVSESISESVSESVSE--SVSESISESVSESVSESISESvsESVSESIS 2091
                         22222222222222222..1222222222222222222222222222222 PP

  == domain 6  score: 26.5 bits;  conditional E-value: 2.9e-10
             DUF445   77 k...............nptnkeslaaiveellkeiledlddesikellkknlkkkleevipepllgkllellleeerhkkllddlldrik 151 
                         +                ++++es+++ v+e ++e +++  +es++e +++ +++ ++e i e + +++ ++ ++e   +++++++++ ++
  SwissProt::A1C3L3 2091 SesvsesvsesvsesvSESVSESVSESVSESVSESISESVSESVSESISESVSESVSESISESVSESV-SESISESVSESVSESISESVS 2179
                         11221122122211111122222222222222222222222222222222222222222222222222.222222222222222222222 PP

             DUF445  152 nllkdeevkekikelidelieeesgklvlesivsmflrelt.silekvksdpdhllreeedkkvreliadllndpelaakveklkkkkls 240 
                         + ++++ ++  ++e ++e i+e + + v+es+++++ ++++ si e v + + ++++e++++ v+e +++ ++ +++ ++v ++  + +s
  SwissProt::A1C3L3 2180 ESVSESISE-SVSESVSESISESVSESVSESVSESVSESVSeSISESVSESVSESVSESISESVSESVSESIS-ESVSESVSESVSESVS 2267
                         222111111.222222222222222222333333333222202223333333344444444444444444443.3333444444444444 PP

             DUF445  241 dlevqeyeealwealkdlllkdlneeesllrerisklleklgeklaed..pklreklnkflenaaak 305 
                         +  ++   e+++e++++ ++++++e  s  ++  +++ e+++e+++e+  + + e++ + +++ +++
  SwissProt::A1C3L3 2268 ESVSESVSESVSESVSESISESVSE--SVSESVSESVSESVSESISESvsESVSESISESVSESVSE 2332
                         4444444444444444444444443..1222222222333333333333222222222222222222 PP

  == domain 7  score: 36.5 bits;  conditional E-value: 2.6e-13
             DUF445   79 ptnkeslaaiveellkeiledlddesikellkknlkkkleevipepllgkllellleeerhkkllddlldriknllkdeevkekikelid 168 
                         ++++es+++ v+e ++e +++  +es++e +++ +++ ++e i e + +++ ++ ++e   +++++++++ +++ ++     e i+e ++
  SwissProt::A1C3L3 2304 ESVSESISESVSESVSESISESVSESVSESISESVSESVSESISESVSESV-SESISESVSESVSESISESVSESVS-----ESISESVS 2387
                         222222233333333333333333333333333333333333333333333.2222222222222222222222222.....22222222 PP

             DUF445  169 elieeesgklv....lesivsmflrelts.ilekvksdpdhllreeedkkvreliadllndpelaakveklkkkklsdlevqeyeealwe 253 
                         e ++e   + v    +es+++++ +++++ + e + + + ++++e++++ v+e +++ ++     ++v ++  + +s+  ++   e+++e
  SwissProt::A1C3L3 2388 ESVSESISESVsesvSESVSESISESVSEsVSESISESVSESVSESISESVSESVSESIS-----ESVSESVSESVSESVSESVSESVSE 2472
                         222222222221111222333332222210112233333333333333333333333333.....3333333333333333333333444 PP

             DUF445  254 alkdlllkdlneeesllrerisklleklgeklaed......pklreklnkflenaaakvlekyrldiskiveetvnafdaeeleelIeli 337 
                         ++++ ++++++e  s  +++ +++ e+++e+++e+      + + e++ + +++ +++ + +   +is+ v+e v +   e++     ++
  SwissProt::A1C3L3 2473 SVSESISESVSE--SVSESISESVSESVSESVSESvsesvsESISESVSESISESVSESVSE---SISESVSESVSESISERTLPNTGEN 2557
                         444444444443..223333333333333333333330033333333333333333333333...6666666666655555555555566 PP

             DUF445  338 vgkeLqaIrinGtlvGgliG 357 
                         v++ L ++   G l G+l+G
  SwissProt::A1C3L3 2558 VSSSLGLVGLSGLLFGALLG 2577
                         66666666666666666655 PP



Or compare SwissProt::A1C3L3 to CDD or PaperBLAST